BLASTX nr result
ID: Rehmannia28_contig00054303
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00054303 (447 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32526.1| hypothetical protein MIMGU_mgv1a024036mg, partial... 50 1e-05 >gb|EYU32526.1| hypothetical protein MIMGU_mgv1a024036mg, partial [Erythranthe guttata] Length = 80 Score = 50.4 bits (119), Expect = 1e-05 Identities = 28/52 (53%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +3 Query: 114 RTLHMEKWLR-KQVPLL-EXXXXXXXXXXXXXXCTYIPGQGGGTCTLNEKHF 263 RT EKW+R KQV LL CT+IPGQGGG CTLNEKHF Sbjct: 3 RTPSTEKWVRTKQVDLLGSSLPRAPVPPSSGTSCTHIPGQGGGACTLNEKHF 54