BLASTX nr result
ID: Rehmannia28_contig00054082
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00054082 (318 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETI29806.1| hypothetical protein F443_23078 [Phytophthora par... 57 1e-08 ref|XP_002781333.1| hypothetical protein Pmar_PMAR018133 [Perkin... 55 4e-08 ref|XP_009539701.1| hypothetical protein PHYSODRAFT_289996 [Phyt... 52 7e-07 gb|ACU44975.1| senescence-associated protein-like [Pfiesteria pi... 50 2e-06 gb|KPV71450.1| hypothetical protein RHOBADRAFT_19446 [Rhodotorul... 49 6e-06 gb|EJK58442.1| hypothetical protein THAOC_21444 [Thalassiosira o... 50 6e-06 >gb|ETI29806.1| hypothetical protein F443_23078 [Phytophthora parasitica P1569] Length = 85 Score = 57.0 bits (136), Expect = 1e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 119 TGKMSRCLTSTDSGLEAFSHNPTDGSFAALSYQTTAFTN 3 +GK+ +S DS LEAFSHNPTDGSFAAL++Q TAFTN Sbjct: 26 SGKVIIVYSSMDSDLEAFSHNPTDGSFAALAFQLTAFTN 64 >ref|XP_002781333.1| hypothetical protein Pmar_PMAR018133 [Perkinsus marinus ATCC 50983] gi|239891880|gb|EER13128.1| hypothetical protein Pmar_PMAR018133, partial [Perkinsus marinus ATCC 50983] Length = 69 Score = 55.1 bits (131), Expect = 4e-08 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -2 Query: 110 MSRCLTSTDSGLEAFSHNPTDGSFAALSYQTTAFT 6 + CL+S DSGLEAFS NP DGSFA LS+QTTA T Sbjct: 26 VQHCLSSMDSGLEAFSRNPADGSFAVLSFQTTALT 60 >ref|XP_009539701.1| hypothetical protein PHYSODRAFT_289996 [Phytophthora sojae] gi|695467767|ref|XP_009539704.1| hypothetical protein PHYSODRAFT_290431 [Phytophthora sojae] gi|695467812|ref|XP_009539715.1| hypothetical protein PHYSODRAFT_290508 [Phytophthora sojae] gi|348665023|gb|EGZ04859.1| hypothetical protein PHYSODRAFT_289996 [Phytophthora sojae] gi|348665026|gb|EGZ04862.1| hypothetical protein PHYSODRAFT_290431 [Phytophthora sojae] gi|348665037|gb|EGZ04873.1| hypothetical protein PHYSODRAFT_290508 [Phytophthora sojae] Length = 75 Score = 52.0 bits (123), Expect = 7e-07 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 119 TGKMSRCLTSTDSGLEAFSHNPTDGSFAALSYQTTAFTN 3 +GK+ +S DS LEAFSHNPTDGS AAL++Q TA TN Sbjct: 16 SGKVIIVYSSMDSDLEAFSHNPTDGSLAALAFQLTAVTN 54 >gb|ACU44975.1| senescence-associated protein-like [Pfiesteria piscicida] Length = 61 Score = 50.4 bits (119), Expect = 2e-06 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -2 Query: 101 CLTSTDSGLEAFSHNPTDGSFAALSYQTTAFT 6 CL S DS LEAFS NPTDGSFA L++Q AFT Sbjct: 20 CLASMDSDLEAFSRNPTDGSFAVLAFQLAAFT 51 >gb|KPV71450.1| hypothetical protein RHOBADRAFT_19446 [Rhodotorula graminis WP1] gi|939609418|gb|KPV71455.1| hypothetical protein RHOBADRAFT_19437 [Rhodotorula graminis WP1] gi|939609425|gb|KPV71462.1| hypothetical protein RHOBADRAFT_19473 [Rhodotorula graminis WP1] gi|939609431|gb|KPV71468.1| hypothetical protein RHOBADRAFT_19482 [Rhodotorula graminis WP1] gi|939609437|gb|KPV71474.1| hypothetical protein RHOBADRAFT_19397 [Rhodotorula graminis WP1] gi|939609443|gb|KPV71480.1| hypothetical protein RHOBADRAFT_19401 [Rhodotorula graminis WP1] gi|939609449|gb|KPV71486.1| hypothetical protein RHOBADRAFT_19445 [Rhodotorula graminis WP1] gi|939609456|gb|KPV71493.1| hypothetical protein RHOBADRAFT_19413 [Rhodotorula graminis WP1] Length = 61 Score = 49.3 bits (116), Expect = 6e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -2 Query: 98 LTSTDSGLEAFSHNPTDGSFAALSYQTTAFTN 3 ++STDSGLEAFSHNPT GSFAAL +T A TN Sbjct: 21 VSSTDSGLEAFSHNPTRGSFAALPDRTAANTN 52 >gb|EJK58442.1| hypothetical protein THAOC_21444 [Thalassiosira oceanica] Length = 78 Score = 49.7 bits (117), Expect = 6e-06 Identities = 27/46 (58%), Positives = 29/46 (63%) Frame = -2 Query: 140 TIDTHLNTGKMSRCLTSTDSGLEAFSHNPTDGSFAALSYQTTAFTN 3 TI T + K L S DS LEAFSHNPTD SFAAL+ Q TA N Sbjct: 2 TIATQVTLVKGDVILASMDSDLEAFSHNPTDDSFAALAVQPTALPN 47