BLASTX nr result
ID: Rehmannia28_contig00053582
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00053582 (537 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007201966.1| hypothetical protein PRUPE_ppa004723mg [Prun... 55 6e-06 ref|XP_008241733.1| PREDICTED: periodic tryptophan protein 1 hom... 55 6e-06 >ref|XP_007201966.1| hypothetical protein PRUPE_ppa004723mg [Prunus persica] gi|462397497|gb|EMJ03165.1| hypothetical protein PRUPE_ppa004723mg [Prunus persica] Length = 494 Score = 55.5 bits (132), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 446 HLSLQVQAVAWNHFAHQVLLSGSFDHSVVM 535 H + +VQAVAWNHFAHQVLLSGSFDHSVV+ Sbjct: 300 HHTDKVQAVAWNHFAHQVLLSGSFDHSVVL 329 >ref|XP_008241733.1| PREDICTED: periodic tryptophan protein 1 homolog [Prunus mume] Length = 497 Score = 55.5 bits (132), Expect = 6e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 446 HLSLQVQAVAWNHFAHQVLLSGSFDHSVVM 535 H + +VQAVAWNHFAHQVLLSGSFDHSVV+ Sbjct: 303 HHTDKVQAVAWNHFAHQVLLSGSFDHSVVL 332