BLASTX nr result
ID: Rehmannia28_contig00053515
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00053515 (317 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099502.1| PREDICTED: uncharacterized protein LOC105177... 52 7e-06 >ref|XP_011099502.1| PREDICTED: uncharacterized protein LOC105177908 [Sesamum indicum] Length = 175 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 311 RVTKVIKPNGEIHRLCGPATAAEIMLEKPNFFLV 210 RVTKVI P+GEI RLC P AAE+MLE PN FLV Sbjct: 19 RVTKVIFPSGEIRRLCEPTKAAELMLETPNSFLV 52