BLASTX nr result
ID: Rehmannia28_contig00053212
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00053212 (312 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094254.1| PREDICTED: transcription repressor OFP6-like... 91 9e-21 ref|XP_010654132.1| PREDICTED: transcription repressor OFP6 [Vit... 81 5e-17 ref|XP_012828693.1| PREDICTED: transcription repressor OFP6-like... 80 1e-16 emb|CDP10622.1| unnamed protein product [Coffea canephora] 79 2e-16 ref|XP_011077921.1| PREDICTED: transcription repressor OFP6-like... 74 1e-14 ref|XP_004494234.1| PREDICTED: transcription repressor OFP6 [Cic... 75 1e-14 ref|XP_004228564.1| PREDICTED: transcription repressor OFP6 [Sol... 74 2e-14 ref|XP_006348492.1| PREDICTED: transcription repressor OFP6-like... 74 3e-14 ref|XP_012441589.1| PREDICTED: transcription repressor OFP6-like... 73 9e-14 ref|XP_009612368.1| PREDICTED: transcription repressor OFP6-like... 72 1e-13 ref|XP_009800828.1| PREDICTED: transcription repressor OFP6-like... 72 2e-13 ref|XP_013450173.1| ovate transcriptional repressor [Medicago tr... 72 2e-13 ref|XP_007027919.1| Ovate family protein, putative [Theobroma ca... 72 4e-13 gb|KYP48578.1| hypothetical protein KK1_029729 [Cajanus cajan] 70 6e-13 ref|XP_002530159.1| PREDICTED: transcription repressor OFP6 [Ric... 70 1e-12 ref|XP_012485757.1| PREDICTED: transcription repressor OFP6-like... 70 1e-12 ref|XP_012468138.1| PREDICTED: transcription repressor OFP6-like... 69 3e-12 ref|XP_009611423.1| PREDICTED: transcription repressor OFP6-like... 69 3e-12 ref|XP_015970618.1| PREDICTED: transcription repressor OFP6-like... 68 4e-12 gb|KCW90485.1| hypothetical protein EUGRSUZ_A02608 [Eucalyptus g... 68 5e-12 >ref|XP_011094254.1| PREDICTED: transcription repressor OFP6-like [Sesamum indicum] Length = 185 Score = 90.5 bits (223), Expect = 9e-21 Identities = 43/53 (81%), Positives = 47/53 (88%), Gaps = 5/53 (9%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAG---SPNLH--GMWPARDY 144 ELLNCFLQLN+PYYHGIIVRAFTEIWNGVYSGR+G SPNLH GMW +RD+ Sbjct: 133 ELLNCFLQLNSPYYHGIIVRAFTEIWNGVYSGRSGSGASPNLHGNGMWMSRDF 185 >ref|XP_010654132.1| PREDICTED: transcription repressor OFP6 [Vitis vinifera] Length = 186 Score = 80.9 bits (198), Expect = 5e-17 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAGSPNLHGMWPARDY 144 ELLNCFLQLN+PYYHG+IVRAFTEIWNGV+S R+ SP HG +RD+ Sbjct: 139 ELLNCFLQLNSPYYHGVIVRAFTEIWNGVFSVRSASPKPHGSRKSRDF 186 >ref|XP_012828693.1| PREDICTED: transcription repressor OFP6-like [Erythranthe guttata] gi|604298010|gb|EYU18098.1| hypothetical protein MIMGU_mgv1a014339mg [Erythranthe guttata] Length = 193 Score = 80.1 bits (196), Expect = 1e-16 Identities = 39/54 (72%), Positives = 43/54 (79%), Gaps = 6/54 (11%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGR-----AGSPNLHGMW-PARDY 144 ELLNCFLQLN+PYYHGIIVRAFTEIWNGVY+ +GS NLHG W +RDY Sbjct: 140 ELLNCFLQLNSPYYHGIIVRAFTEIWNGVYNSAGSGSGSGSHNLHGKWMMSRDY 193 >emb|CDP10622.1| unnamed protein product [Coffea canephora] Length = 186 Score = 79.3 bits (194), Expect = 2e-16 Identities = 38/51 (74%), Positives = 43/51 (84%), Gaps = 3/51 (5%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGR--AGSPN-LHGMWPARDY 144 ELLNCFLQLN+PYYHG IVRAFTEIWNGV+S R A SPN LHG+W +R + Sbjct: 136 ELLNCFLQLNSPYYHGTIVRAFTEIWNGVFSVRSTAASPNLLHGLWRSRGF 186 >ref|XP_011077921.1| PREDICTED: transcription repressor OFP6-like [Sesamum indicum] Length = 171 Score = 74.3 bits (181), Expect = 1e-14 Identities = 34/44 (77%), Positives = 39/44 (88%), Gaps = 2/44 (4%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGR--AGSPNLHGM 126 ELLNCFLQLN+PYYHG+IVRAFTEIWNGVYS R + S ++HGM Sbjct: 128 ELLNCFLQLNSPYYHGVIVRAFTEIWNGVYSIRPPSASSDMHGM 171 >ref|XP_004494234.1| PREDICTED: transcription repressor OFP6 [Cicer arietinum] Length = 194 Score = 74.7 bits (182), Expect = 1e-14 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAGSPNLH 120 ELLNCFLQLNAPY+HG+IVRAFTEIWNGV+S R+ S N+H Sbjct: 145 ELLNCFLQLNAPYHHGVIVRAFTEIWNGVFSMRSSSTNVH 184 >ref|XP_004228564.1| PREDICTED: transcription repressor OFP6 [Solanum lycopersicum] gi|969999735|ref|XP_015084368.1| PREDICTED: transcription repressor OFP6 [Solanum pennellii] Length = 182 Score = 73.9 bits (180), Expect = 2e-14 Identities = 36/46 (78%), Positives = 38/46 (82%), Gaps = 5/46 (10%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAG-----SPNLHG 123 ELLNCFLQLN+PYYHGIIVRAFTEIWNGV+S R G SP LHG Sbjct: 130 ELLNCFLQLNSPYYHGIIVRAFTEIWNGVFSLRPGVAGASSPFLHG 175 >ref|XP_006348492.1| PREDICTED: transcription repressor OFP6-like [Solanum tuberosum] Length = 184 Score = 73.6 bits (179), Expect = 3e-14 Identities = 35/46 (76%), Positives = 38/46 (82%), Gaps = 5/46 (10%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAG-----SPNLHG 123 ELLNCFLQLN+PYYHG+IVRAFTEIWNGV+S R G SP LHG Sbjct: 132 ELLNCFLQLNSPYYHGVIVRAFTEIWNGVFSLRPGVAGASSPFLHG 177 >ref|XP_012441589.1| PREDICTED: transcription repressor OFP6-like [Gossypium raimondii] gi|763795046|gb|KJB62042.1| hypothetical protein B456_009G398100 [Gossypium raimondii] Length = 203 Score = 72.8 bits (177), Expect = 9e-14 Identities = 34/54 (62%), Positives = 40/54 (74%), Gaps = 6/54 (11%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYS------GRAGSPNLHGMWPARDY 144 ELLNCFLQLN+PYYHGII+RAFTEIWNGV++ G SP LH + RD+ Sbjct: 150 ELLNCFLQLNSPYYHGIIIRAFTEIWNGVFNVKPGGGGAGASPELHFGFRPRDF 203 >ref|XP_009612368.1| PREDICTED: transcription repressor OFP6-like [Nicotiana tomentosiformis] Length = 193 Score = 72.0 bits (175), Expect = 1e-13 Identities = 35/46 (76%), Positives = 38/46 (82%), Gaps = 5/46 (10%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAG-----SPNLHG 123 ELL+CFLQLN+PYYHGIIVRAFTEIWNGV+S R G SP LHG Sbjct: 141 ELLHCFLQLNSPYYHGIIVRAFTEIWNGVFSLRPGAVGASSPFLHG 186 >ref|XP_009800828.1| PREDICTED: transcription repressor OFP6-like [Nicotiana sylvestris] Length = 198 Score = 72.0 bits (175), Expect = 2e-13 Identities = 35/46 (76%), Positives = 38/46 (82%), Gaps = 5/46 (10%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAG-----SPNLHG 123 ELL+CFLQLN+PYYHGIIVRAFTEIWNGV+S R G SP LHG Sbjct: 146 ELLHCFLQLNSPYYHGIIVRAFTEIWNGVFSLRPGAVGASSPFLHG 191 >ref|XP_013450173.1| ovate transcriptional repressor [Medicago truncatula] gi|657379922|gb|KEH24201.1| ovate transcriptional repressor [Medicago truncatula] Length = 199 Score = 72.0 bits (175), Expect = 2e-13 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAGSPNLH 120 ELLNCFLQLNAPY+HG+IVRAFTEIWNGV R SP+LH Sbjct: 146 ELLNCFLQLNAPYHHGVIVRAFTEIWNGVSIMRPSSPSLH 185 >ref|XP_007027919.1| Ovate family protein, putative [Theobroma cacao] gi|508716524|gb|EOY08421.1| Ovate family protein, putative [Theobroma cacao] Length = 254 Score = 72.0 bits (175), Expect = 4e-13 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 2/50 (4%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAG--SPNLHGMWPARDY 144 ELLNCFLQLN+P++HGIIVRAFTEIWNGV+S + G SP LH + RD+ Sbjct: 205 ELLNCFLQLNSPHHHGIIVRAFTEIWNGVFSVKPGGASPKLHFGYRPRDF 254 >gb|KYP48578.1| hypothetical protein KK1_029729 [Cajanus cajan] Length = 181 Score = 70.1 bits (170), Expect = 6e-13 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAGSPNLH 120 ELLNCFLQLN+P++HG+IVRAFTEIWNGV+S R+ SP ++ Sbjct: 134 ELLNCFLQLNSPHHHGVIVRAFTEIWNGVFSVRSSSPRIN 173 >ref|XP_002530159.1| PREDICTED: transcription repressor OFP6 [Ricinus communis] gi|223530320|gb|EEF32214.1| conserved hypothetical protein [Ricinus communis] Length = 209 Score = 70.1 bits (170), Expect = 1e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAGSPN 114 ELLNCFLQLN+PY+HGIIVRAFTEIWNGVYS ++ S N Sbjct: 148 ELLNCFLQLNSPYHHGIIVRAFTEIWNGVYSVKSSSYN 185 >ref|XP_012485757.1| PREDICTED: transcription repressor OFP6-like [Gossypium raimondii] gi|763769075|gb|KJB36290.1| hypothetical protein B456_006G150900 [Gossypium raimondii] Length = 194 Score = 69.7 bits (169), Expect = 1e-12 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAGS 108 ELLNCFLQLN+PYYHGIIVRAFTEIWNGV+S + G+ Sbjct: 146 ELLNCFLQLNSPYYHGIIVRAFTEIWNGVFSVKPGA 181 >ref|XP_012468138.1| PREDICTED: transcription repressor OFP6-like [Gossypium raimondii] gi|763745259|gb|KJB12698.1| hypothetical protein B456_002G236400 [Gossypium raimondii] Length = 204 Score = 68.9 bits (167), Expect = 3e-12 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAGS 108 ELLNCFLQLN+PY+HGIIVRAFTEIWNGV+S + GS Sbjct: 152 ELLNCFLQLNSPYHHGIIVRAFTEIWNGVFSVKPGS 187 >ref|XP_009611423.1| PREDICTED: transcription repressor OFP6-like [Nicotiana tomentosiformis] Length = 188 Score = 68.6 bits (166), Expect = 3e-12 Identities = 34/57 (59%), Positives = 42/57 (73%), Gaps = 9/57 (15%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAG-----SPNLHGM----WPARDY 144 ELLNCFL+LN+PYYHG+IVRAFTEIW+ V+S + G SP LHG W +RD+ Sbjct: 132 ELLNCFLELNSPYYHGVIVRAFTEIWHCVFSLKPGVVGAESPFLHGSGGGGWCSRDF 188 >ref|XP_015970618.1| PREDICTED: transcription repressor OFP6-like [Arachis duranensis] Length = 191 Score = 68.2 bits (165), Expect = 4e-12 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAGS 108 ELLNCFLQLN+PY+HG+IVRAFTEIWNGV+S R+ S Sbjct: 139 ELLNCFLQLNSPYHHGVIVRAFTEIWNGVFSVRSSS 174 >gb|KCW90485.1| hypothetical protein EUGRSUZ_A02608 [Eucalyptus grandis] Length = 199 Score = 68.2 bits (165), Expect = 5e-12 Identities = 32/52 (61%), Positives = 39/52 (75%), Gaps = 4/52 (7%) Frame = +1 Query: 1 ELLNCFLQLNAPYYHGIIVRAFTEIWNGVYSGRAG----SPNLHGMWPARDY 144 ELLNCFLQLN+P+YHG+IVRAFTEIWNGV+ R SP LH + + +Y Sbjct: 148 ELLNCFLQLNSPHYHGVIVRAFTEIWNGVFCDRPAAGHHSPLLHFAYKSWEY 199