BLASTX nr result
ID: Rehmannia28_contig00053024
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00053024 (333 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849923.1| PREDICTED: uncharacterized protein LOC105969... 74 3e-13 gb|EYU26931.1| hypothetical protein MIMGU_mgv1a009497mg [Erythra... 72 7e-13 ref|XP_011086274.1| PREDICTED: uncharacterized protein LOC105168... 64 4e-10 ref|XP_002299187.2| hypothetical protein POPTR_0001s06910g [Popu... 60 1e-08 ref|XP_011034700.1| PREDICTED: uncharacterized protein LOC105132... 60 1e-08 ref|XP_011020440.1| PREDICTED: uncharacterized protein LOC105122... 57 3e-07 ref|XP_002303944.1| hypothetical protein POPTR_0003s19320g [Popu... 57 3e-07 ref|XP_010095975.1| hypothetical protein L484_023964 [Morus nota... 55 1e-06 ref|XP_007010825.1| MATH and LRR domain-containing protein PFE05... 54 4e-06 ref|XP_007010824.1| MATH and LRR domain-containing protein PFE05... 54 4e-06 gb|ACU18276.1| unknown [Glycine max] 50 1e-05 >ref|XP_012849923.1| PREDICTED: uncharacterized protein LOC105969696 [Erythranthe guttata] Length = 430 Score = 73.9 bits (180), Expect = 3e-13 Identities = 45/104 (43%), Positives = 61/104 (58%), Gaps = 10/104 (9%) Frame = +2 Query: 38 CSDLQHTISSWV--FFTPQNQESIHLV-----NLMEWYSGSAVEDLAVPNNEEIYDRLPS 196 CS L SS + FF ++ +I N MEWY + +E+L VP +EE+ DRLPS Sbjct: 57 CSQLSPLSSSLLLGFFFNSSKSTISTSGKSESNPMEWYFANNMENLTVPKDEEMMDRLPS 116 Query: 197 PDSWSSWGKIM---NSSKKLNMLGMEECPLRETMFSSGDVEQRD 319 PDSWSSWGK++ NS KKL +LG+E+ L + + DV D Sbjct: 117 PDSWSSWGKVVGNFNSPKKLTVLGVEDFLLNDN--NDDDVNDDD 158 >gb|EYU26931.1| hypothetical protein MIMGU_mgv1a009497mg [Erythranthe guttata] Length = 340 Score = 72.4 bits (176), Expect = 7e-13 Identities = 36/70 (51%), Positives = 48/70 (68%), Gaps = 3/70 (4%) Frame = +2 Query: 119 MEWYSGSAVEDLAVPNNEEIYDRLPSPDSWSSWGKIM---NSSKKLNMLGMEECPLRETM 289 MEWY + +E+L VP +EE+ DRLPSPDSWSSWGK++ NS KKL +LG+E+ L + Sbjct: 1 MEWYFANNMENLTVPKDEEMMDRLPSPDSWSSWGKVVGNFNSPKKLTVLGVEDFLLNDN- 59 Query: 290 FSSGDVEQRD 319 + DV D Sbjct: 60 -NDDDVNDDD 68 >ref|XP_011086274.1| PREDICTED: uncharacterized protein LOC105168054 [Sesamum indicum] Length = 278 Score = 64.3 bits (155), Expect = 4e-10 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 4/64 (6%) Frame = +2 Query: 119 MEWYSGSAVEDLAVPNNEEIYDRLPSPDSWSSWGKIMN----SSKKLNMLGMEECPLRET 286 MEWYS S +EDL++P +EEI+DR PSPDSWSS K++ S ++L +L +EE T Sbjct: 1 MEWYSSSGIEDLSLPKHEEIFDRRPSPDSWSSCSKMVGNFNCSPEELTVLDVEELLFCGT 60 Query: 287 MFSS 298 F S Sbjct: 61 AFCS 64 >ref|XP_002299187.2| hypothetical protein POPTR_0001s06910g [Populus trichocarpa] gi|550346699|gb|EEE83992.2| hypothetical protein POPTR_0001s06910g [Populus trichocarpa] Length = 392 Score = 60.5 bits (145), Expect = 1e-08 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +2 Query: 119 MEWYSGSAVEDLAVPNNEEIYDRLPSPDSWSSW 217 MEWYSGS ++D VP + E+YDRLPSP+SWS W Sbjct: 1 MEWYSGSGIDDFVVPEDREVYDRLPSPESWSKW 33 >ref|XP_011034700.1| PREDICTED: uncharacterized protein LOC105132731 [Populus euphratica] Length = 394 Score = 60.5 bits (145), Expect = 1e-08 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = +2 Query: 119 MEWYSGSAVEDLAVPNNEEIYDRLPSPDSWSSW 217 MEWYSGS ++D VP + E+YDRLPSP+SWS W Sbjct: 1 MEWYSGSGIDDFVVPEDREVYDRLPSPESWSKW 33 >ref|XP_011020440.1| PREDICTED: uncharacterized protein LOC105122828 [Populus euphratica] gi|743817567|ref|XP_011020441.1| PREDICTED: uncharacterized protein LOC105122828 [Populus euphratica] Length = 382 Score = 56.6 bits (135), Expect = 3e-07 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = +2 Query: 119 MEWYSGSAVEDLAVPNNEEIYDRLPSPDSWSSW 217 MEWYS V+D VP ++E+YDRLPSP+SWS W Sbjct: 1 MEWYSEDCVDDFEVPKDQEVYDRLPSPESWSKW 33 >ref|XP_002303944.1| hypothetical protein POPTR_0003s19320g [Populus trichocarpa] gi|222841376|gb|EEE78923.1| hypothetical protein POPTR_0003s19320g [Populus trichocarpa] Length = 427 Score = 56.6 bits (135), Expect = 3e-07 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = +2 Query: 119 MEWYSGSAVEDLAVPNNEEIYDRLPSPDSWSSW 217 MEWYS ++D VP ++E+YDRLPSP+SWS W Sbjct: 1 MEWYSDDCIDDFEVPKDQEVYDRLPSPESWSKW 33 >ref|XP_010095975.1| hypothetical protein L484_023964 [Morus notabilis] gi|587873483|gb|EXB62668.1| hypothetical protein L484_023964 [Morus notabilis] Length = 452 Score = 55.1 bits (131), Expect = 1e-06 Identities = 21/35 (60%), Positives = 27/35 (77%) Frame = +2 Query: 116 LMEWYSGSAVEDLAVPNNEEIYDRLPSPDSWSSWG 220 LM+WYS + ++DL VP + + DRLPSPDSWS WG Sbjct: 42 LMDWYSANGIDDLIVPKDGGLSDRLPSPDSWSKWG 76 >ref|XP_007010825.1| MATH and LRR domain-containing protein PFE0570w, putative isoform 2 [Theobroma cacao] gi|508727738|gb|EOY19635.1| MATH and LRR domain-containing protein PFE0570w, putative isoform 2 [Theobroma cacao] Length = 395 Score = 53.5 bits (127), Expect = 4e-06 Identities = 20/34 (58%), Positives = 27/34 (79%) Frame = +2 Query: 119 MEWYSGSAVEDLAVPNNEEIYDRLPSPDSWSSWG 220 M+W G+ +EDL VP ++E+ DRLPSP+SWS WG Sbjct: 1 MDWCFGNGIEDLVVPMDQELADRLPSPESWSKWG 34 >ref|XP_007010824.1| MATH and LRR domain-containing protein PFE0570w, putative isoform 1 [Theobroma cacao] gi|508727737|gb|EOY19634.1| MATH and LRR domain-containing protein PFE0570w, putative isoform 1 [Theobroma cacao] Length = 535 Score = 53.5 bits (127), Expect = 4e-06 Identities = 20/34 (58%), Positives = 27/34 (79%) Frame = +2 Query: 119 MEWYSGSAVEDLAVPNNEEIYDRLPSPDSWSSWG 220 M+W G+ +EDL VP ++E+ DRLPSP+SWS WG Sbjct: 34 MDWCFGNGIEDLVVPMDQELADRLPSPESWSKWG 67 >gb|ACU18276.1| unknown [Glycine max] Length = 109 Score = 50.1 bits (118), Expect = 1e-05 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 4/54 (7%) Frame = +2 Query: 119 MEWYSGSAVEDLAVPNNEEIYDRLPSPDSWSSWG----KIMNSSKKLNMLGMEE 268 M+WY G+ + D VP ++++ DR PSPD WS+WG + NS K L ++ E Sbjct: 1 MDWYYGNGINDYLVPRDQDLLDRHPSPDYWSNWGIGATEGFNSPKNLFIMDFFE 54