BLASTX nr result
ID: Rehmannia28_contig00053002
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00053002 (560 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010098383.1| hypothetical protein L484_018615 [Morus nota... 55 5e-07 emb|CAN74951.1| hypothetical protein VITISV_030567 [Vitis vinifera] 55 8e-06 >ref|XP_010098383.1| hypothetical protein L484_018615 [Morus notabilis] gi|587886073|gb|EXB74907.1| hypothetical protein L484_018615 [Morus notabilis] Length = 106 Score = 55.5 bits (132), Expect = 5e-07 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -2 Query: 559 SIVDDIHAAGKVVDDDDLMLYILHGLGPEYESVVVNLTSKK 437 SIVD+++A G+V+ +DDL+L IL GLG EY+ VVVNLTS+K Sbjct: 66 SIVDNLNATGQVISNDDLVLCILGGLGSEYDPVVVNLTSRK 106 >emb|CAN74951.1| hypothetical protein VITISV_030567 [Vitis vinifera] Length = 2203 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/44 (54%), Positives = 36/44 (81%) Frame = -2 Query: 559 SIVDDIHAAGKVVDDDDLMLYILHGLGPEYESVVVNLTSKKDLL 428 +I D + A+GK V D+DL+LYIL GLGPE+E++VVN+TS+ + + Sbjct: 56 NIADMLSASGKPVPDEDLILYILGGLGPEFETIVVNITSRSEAI 99