BLASTX nr result
ID: Rehmannia28_contig00052284
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00052284 (372 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETI29806.1| hypothetical protein F443_23078 [Phytophthora par... 51 4e-06 >gb|ETI29806.1| hypothetical protein F443_23078 [Phytophthora parasitica P1569] Length = 85 Score = 50.8 bits (120), Expect = 4e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +2 Query: 203 SSMDSDLEAFSRNPTHGSFAALAVQRTANTN 295 SSMDSDLEAFS NPT GSFAALA Q TA TN Sbjct: 34 SSMDSDLEAFSHNPTDGSFAALAFQLTAFTN 64