BLASTX nr result
ID: Rehmannia28_contig00052051
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00052051 (371 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH90711.1| Ribosomal protein 60S [Cynara cardunculus var. sc... 54 5e-07 ref|XP_002266030.2| PREDICTED: 60S acidic ribosomal protein P2 i... 54 7e-07 ref|XP_012468193.1| PREDICTED: 60S acidic ribosomal protein P2A-... 53 1e-06 gb|KHN02245.1| 60S acidic ribosomal protein P2 [Glycine soja] 51 2e-06 gb|KVI00086.1| Ribosomal protein 60S, partial [Cynara cardunculu... 53 2e-06 ref|XP_012075885.1| PREDICTED: 60S acidic ribosomal protein P2A-... 52 2e-06 ref|XP_011090363.1| PREDICTED: 60S acidic ribosomal protein P2B-... 52 2e-06 ref|XP_011462847.1| PREDICTED: 60S acidic ribosomal protein P2B-... 52 2e-06 ref|XP_004297919.1| PREDICTED: 60S acidic ribosomal protein P2B-... 52 2e-06 ref|XP_004293299.1| PREDICTED: 60S acidic ribosomal protein P2-l... 51 2e-06 ref|XP_008783987.1| PREDICTED: 60S acidic ribosomal protein P2B-... 52 3e-06 ref|XP_006430260.1| hypothetical protein CICLE_v10013051mg [Citr... 52 4e-06 ref|XP_010907155.1| PREDICTED: 60S acidic ribosomal protein P2B-... 52 4e-06 ref|XP_002529063.1| PREDICTED: 60S acidic ribosomal protein P2A ... 52 4e-06 ref|XP_006481819.1| PREDICTED: 60S acidic ribosomal protein P2-4... 52 4e-06 gb|AFK40789.1| unknown [Lotus japonicus] 52 4e-06 gb|KJB06824.1| hypothetical protein B456_001G120800 [Gossypium r... 50 4e-06 ref|XP_007162878.1| hypothetical protein PHAVU_001G1882000g, par... 53 4e-06 ref|XP_010069674.1| PREDICTED: 60S acidic ribosomal protein P2A-... 52 4e-06 gb|KYP71096.1| 60S acidic ribosomal protein P2-4 [Cajanus cajan] 52 4e-06 >gb|KVH90711.1| Ribosomal protein 60S [Cynara cardunculus var. scolymus] Length = 115 Score = 53.9 bits (128), Expect = 5e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKV+AAYLLA+LGGNTSPSADDL+KILG Sbjct: 1 MKVVAAYLLALLGGNTSPSADDLKKILG 28 >ref|XP_002266030.2| PREDICTED: 60S acidic ribosomal protein P2 isoform X1 [Vitis vinifera] gi|297734823|emb|CBI17057.3| unnamed protein product [Vitis vinifera] Length = 145 Score = 54.3 bits (129), Expect = 7e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 226 RRQSPKMKVIAAYLLAVLGGNTSPSADDLRKILG 327 RR KMKVIAAYLLAVLGGNT PSA+DL+ ILG Sbjct: 27 RRSHHKMKVIAAYLLAVLGGNTCPSAEDLKDILG 60 >ref|XP_012468193.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Gossypium raimondii] gi|763749201|gb|KJB16640.1| hypothetical protein B456_002G241200 [Gossypium raimondii] Length = 113 Score = 52.8 bits (125), Expect = 1e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKV+AAYLLAVLGGNTSPSADDL+ ILG Sbjct: 1 MKVVAAYLLAVLGGNTSPSADDLKAILG 28 >gb|KHN02245.1| 60S acidic ribosomal protein P2 [Glycine soja] Length = 64 Score = 51.2 bits (121), Expect = 2e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKVIAAYLLAVLGGN +PSADDLR ILG Sbjct: 1 MKVIAAYLLAVLGGNAAPSADDLRTILG 28 >gb|KVI00086.1| Ribosomal protein 60S, partial [Cynara cardunculus var. scolymus] Length = 146 Score = 53.1 bits (126), Expect = 2e-06 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = +1 Query: 241 KMKVIAAYLLAVLGGNTSPSADDLRKILG 327 +MKV+AAYLLA+LGGNTSPSA+DL+KILG Sbjct: 32 RMKVVAAYLLALLGGNTSPSAEDLKKILG 60 >ref|XP_012075885.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Jatropha curcas] gi|643725793|gb|KDP34714.1| hypothetical protein JCGZ_10919 [Jatropha curcas] Length = 114 Score = 52.4 bits (124), Expect = 2e-06 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKVIAAYLLAVLGGNTSPSA+DL++ILG Sbjct: 1 MKVIAAYLLAVLGGNTSPSAEDLKEILG 28 >ref|XP_011090363.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Sesamum indicum] Length = 115 Score = 52.4 bits (124), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MK++AAYLLAVLGGNTSPSADDL+ ILG Sbjct: 1 MKIVAAYLLAVLGGNTSPSADDLKDILG 28 >ref|XP_011462847.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Fragaria vesca subsp. vesca] Length = 122 Score = 52.4 bits (124), Expect = 2e-06 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKVIAAY+LAVLGGNTSP+ADD++KILG Sbjct: 1 MKVIAAYMLAVLGGNTSPTADDVKKILG 28 >ref|XP_004297919.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Fragaria vesca subsp. vesca] Length = 122 Score = 52.4 bits (124), Expect = 2e-06 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKVIAAY+LAVLGGNTSP+ADD++KILG Sbjct: 1 MKVIAAYMLAVLGGNTSPTADDVKKILG 28 >ref|XP_004293299.1| PREDICTED: 60S acidic ribosomal protein P2-like [Fragaria vesca subsp. vesca] Length = 113 Score = 51.2 bits (121), Expect(2) = 2e-06 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKV+AAY+LAVLGGN SPSADD++KILG Sbjct: 1 MKVVAAYMLAVLGGNASPSADDVKKILG 28 Score = 26.9 bits (58), Expect(2) = 2e-06 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 320 SSADTKKIELLLSQIKG 370 + AD KIELLLSQ+KG Sbjct: 32 AEADDNKIELLLSQLKG 48 >ref|XP_008783987.1| PREDICTED: 60S acidic ribosomal protein P2B-like isoform X1 [Phoenix dactylifera] Length = 112 Score = 52.0 bits (123), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKVIAAYLLAVLGGNTSP+ADDL+ ILG Sbjct: 1 MKVIAAYLLAVLGGNTSPTADDLKDILG 28 >ref|XP_006430260.1| hypothetical protein CICLE_v10013051mg [Citrus clementina] gi|557532317|gb|ESR43500.1| hypothetical protein CICLE_v10013051mg [Citrus clementina] Length = 144 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 232 QSPKMKVIAAYLLAVLGGNTSPSADDLRKILG 327 + +MKV+AAYLLAVLGGNTSPSADD++ ILG Sbjct: 28 EKEEMKVVAAYLLAVLGGNTSPSADDIKGILG 59 >ref|XP_010907155.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Elaeis guineensis] Length = 112 Score = 51.6 bits (122), Expect = 4e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKV+AAYLLAVLGGNTSP+ADDL+ ILG Sbjct: 1 MKVVAAYLLAVLGGNTSPTADDLKDILG 28 >ref|XP_002529063.1| PREDICTED: 60S acidic ribosomal protein P2A [Ricinus communis] gi|223531475|gb|EEF33307.1| 60S acidic ribosomal protein P2, putative [Ricinus communis] Length = 113 Score = 51.6 bits (122), Expect = 4e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MK++AAYLLAVLGGNTSPSA+DL++ILG Sbjct: 1 MKIVAAYLLAVLGGNTSPSAEDLKEILG 28 >ref|XP_006481819.1| PREDICTED: 60S acidic ribosomal protein P2-4 [Citrus sinensis] gi|641842176|gb|KDO61084.1| hypothetical protein CISIN_1g033355mg [Citrus sinensis] Length = 113 Score = 51.6 bits (122), Expect = 4e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKV+AAYLLAVLGGNTSPSADD++ ILG Sbjct: 1 MKVVAAYLLAVLGGNTSPSADDIKGILG 28 >gb|AFK40789.1| unknown [Lotus japonicus] Length = 115 Score = 51.6 bits (122), Expect = 4e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKV+AAYLLAVLGGN+SPSADDL+ ILG Sbjct: 1 MKVVAAYLLAVLGGNSSPSADDLKNILG 28 >gb|KJB06824.1| hypothetical protein B456_001G120800 [Gossypium raimondii] Length = 114 Score = 50.4 bits (119), Expect(2) = 4e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKVIAA+LLAVLGGNT+PSADDL+ ILG Sbjct: 1 MKVIAAFLLAVLGGNTNPSADDLKAILG 28 Score = 26.9 bits (58), Expect(2) = 4e-06 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 314 GRSSADTKKIELLLSQIKG 370 G + AD KIE+LLS++KG Sbjct: 28 GSAEADDDKIEMLLSEVKG 46 >ref|XP_007162878.1| hypothetical protein PHAVU_001G1882000g, partial [Phaseolus vulgaris] gi|561036342|gb|ESW34872.1| hypothetical protein PHAVU_001G1882000g, partial [Phaseolus vulgaris] Length = 176 Score = 52.8 bits (125), Expect = 4e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 241 KMKVIAAYLLAVLGGNTSPSADDLRKILG 327 KMKVIAAYLLAVLGGN +PSADDLR ILG Sbjct: 71 KMKVIAAYLLAVLGGNAAPSADDLRLILG 99 >ref|XP_010069674.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Eucalyptus grandis] Length = 116 Score = 51.6 bits (122), Expect = 4e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKVIAAYLLAVLGGNT+PSADDL+ ILG Sbjct: 1 MKVIAAYLLAVLGGNTTPSADDLKGILG 28 >gb|KYP71096.1| 60S acidic ribosomal protein P2-4 [Cajanus cajan] Length = 117 Score = 51.6 bits (122), Expect = 4e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 244 MKVIAAYLLAVLGGNTSPSADDLRKILG 327 MKVIAAYLLAVLGGN++PSADDLR ILG Sbjct: 1 MKVIAAYLLAVLGGNSAPSADDLRDILG 28