BLASTX nr result
ID: Rehmannia28_contig00051183
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00051183 (459 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072399.1| PREDICTED: remorin [Sesamum indicum] 67 3e-11 gb|EYU38364.1| hypothetical protein MIMGU_mgv1a022944mg, partial... 55 1e-07 gb|KYP74881.1| Remorin, partial [Cajanus cajan] 57 1e-07 gb|KYP49411.1| Remorin [Cajanus cajan] 55 1e-07 ref|XP_014512214.1| PREDICTED: remorin-like isoform X2 [Vigna ra... 57 2e-07 ref|XP_014512213.1| PREDICTED: remorin-like isoform X1 [Vigna ra... 57 3e-07 gb|KOM35975.1| hypothetical protein LR48_Vigan02g212500 [Vigna a... 57 3e-07 gb|ABK95953.1| unknown [Populus trichocarpa] 54 4e-07 ref|XP_015933877.1| PREDICTED: remorin [Arachis duranensis] 57 4e-07 emb|CDP09770.1| unnamed protein product [Coffea canephora] 57 5e-07 gb|AGG82489.1| remorin 2 [Datisca glomerata] 56 5e-07 ref|XP_007040179.1| Remorin family protein [Theobroma cacao] gi|... 57 6e-07 ref|XP_008234255.1| PREDICTED: remorin-like [Prunus mume] 56 7e-07 ref|XP_011652698.1| PREDICTED: remorin-like [Cucumis sativus] gi... 56 8e-07 ref|XP_008465865.1| PREDICTED: remorin [Cucumis melo] 56 8e-07 gb|KYP49428.1| Uncharacterized protein At3g61260 family [Cajanus... 55 8e-07 ref|XP_012836260.1| PREDICTED: remorin-like [Erythranthe guttata] 55 9e-07 ref|XP_003556104.1| PREDICTED: remorin-like [Glycine max] gi|734... 55 2e-06 ref|XP_014516587.1| PREDICTED: remorin-like [Vigna radiata var. ... 55 2e-06 gb|AGR88905.1| remorin 1 [Datisca glomerata] 55 2e-06 >ref|XP_011072399.1| PREDICTED: remorin [Sesamum indicum] Length = 165 Score = 67.0 bits (162), Expect = 3e-11 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACFSC 344 RA++EADRG+D L+VEE A KYRATG+ PKKLFACFSC Sbjct: 128 RAMVEADRGKDLLMVEEAAAKYRATGNVPKKLFACFSC 165 >gb|EYU38364.1| hypothetical protein MIMGU_mgv1a022944mg, partial [Erythranthe guttata] Length = 70 Score = 55.5 bits (132), Expect = 1e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACFS 347 +A IEADR +FL VEE A K+RATG PKKLFACFS Sbjct: 32 KASIEADRAGEFLTVEEVASKFRATGRIPKKLFACFS 68 >gb|KYP74881.1| Remorin, partial [Cajanus cajan] Length = 138 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACF 350 RA IEA +G DFL EETA KYRATG+ PKKLF CF Sbjct: 103 RAFIEAKKGEDFLKAEETAAKYRATGTAPKKLFGCF 138 >gb|KYP49411.1| Remorin [Cajanus cajan] Length = 51 Score = 54.7 bits (130), Expect = 1e-07 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACF 350 RA++EA RG + L EETA KYRATG+TPKK F CF Sbjct: 16 RAMVEAKRGEEILKAEETAAKYRATGTTPKKAFGCF 51 >ref|XP_014512214.1| PREDICTED: remorin-like isoform X2 [Vigna radiata var. radiata] Length = 156 Score = 57.0 bits (136), Expect = 2e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACF 350 RA IEA +G DFL EETA KYRATG+ PKKLF CF Sbjct: 120 RAFIEAKKGEDFLKAEETAAKYRATGTAPKKLFGCF 155 >ref|XP_014512213.1| PREDICTED: remorin-like isoform X1 [Vigna radiata var. radiata] Length = 192 Score = 57.0 bits (136), Expect = 3e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACF 350 RA IEA +G DFL EETA KYRATG+ PKKLF CF Sbjct: 156 RAFIEAKKGEDFLKAEETAAKYRATGTAPKKLFGCF 191 >gb|KOM35975.1| hypothetical protein LR48_Vigan02g212500 [Vigna angularis] gi|965607711|dbj|BAT94202.1| hypothetical protein VIGAN_08078000 [Vigna angularis var. angularis] Length = 197 Score = 57.0 bits (136), Expect = 3e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACF 350 RA IEA +G DFL EETA KYRATG+ PKKLF CF Sbjct: 161 RAFIEAKKGEDFLKAEETAAKYRATGTAPKKLFGCF 196 >gb|ABK95953.1| unknown [Populus trichocarpa] Length = 66 Score = 53.9 bits (128), Expect = 4e-07 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACF 350 RA++EA RG +FL EE A KYRATG TPKKL CF Sbjct: 31 RAMVEAKRGEEFLKAEEMAAKYRATGQTPKKLLGCF 66 >ref|XP_015933877.1| PREDICTED: remorin [Arachis duranensis] Length = 192 Score = 56.6 bits (135), Expect = 4e-07 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACF 350 RA++EA RG +FL EETA KYRATG+TPKKL CF Sbjct: 157 RAMVEAKRGEEFLKAEETAAKYRATGTTPKKLLGCF 192 >emb|CDP09770.1| unnamed protein product [Coffea canephora] Length = 212 Score = 56.6 bits (135), Expect = 5e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACF 350 RA++EA RG D L VEETA K+R+TG+ PKKLFACF Sbjct: 175 RAMVEAKRGEDILKVEETAAKFRSTGNVPKKLFACF 210 >gb|AGG82489.1| remorin 2 [Datisca glomerata] Length = 187 Score = 56.2 bits (134), Expect = 5e-07 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACFS 347 RA++EA RG FL VEETA KYRA G PKKLF CFS Sbjct: 150 RAVVEASRGEQFLKVEETAAKYRAAGFAPKKLFGCFS 186 >ref|XP_007040179.1| Remorin family protein [Theobroma cacao] gi|508777424|gb|EOY24680.1| Remorin family protein [Theobroma cacao] Length = 274 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACFS 347 RA+IEA RG DFL +EETA K+RATG TPKK CFS Sbjct: 237 RAMIEAKRGEDFLKIEETAAKFRATGYTPKKFLGCFS 273 >ref|XP_008234255.1| PREDICTED: remorin-like [Prunus mume] Length = 212 Score = 56.2 bits (134), Expect = 7e-07 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACFS 347 RA IEA RG D L EETA KYRATG+ PKKL ACFS Sbjct: 175 RAAIEAKRGEDLLKAEETAAKYRATGNAPKKLLACFS 211 >ref|XP_011652698.1| PREDICTED: remorin-like [Cucumis sativus] gi|700205348|gb|KGN60481.1| hypothetical protein Csa_3G915100 [Cucumis sativus] Length = 189 Score = 55.8 bits (133), Expect = 8e-07 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACFS 347 RA+IEA RG D L EETA KYRATG+ PKKL CFS Sbjct: 152 RAIIEAKRGEDLLKAEETAAKYRATGTAPKKLLGCFS 188 >ref|XP_008465865.1| PREDICTED: remorin [Cucumis melo] Length = 193 Score = 55.8 bits (133), Expect = 8e-07 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACFS 347 RA+IEA RG D L EETA KYRATG+ PKKL CFS Sbjct: 156 RAIIEAKRGEDLLKAEETAAKYRATGTAPKKLLGCFS 192 >gb|KYP49428.1| Uncharacterized protein At3g61260 family [Cajanus cajan] Length = 134 Score = 54.7 bits (130), Expect = 8e-07 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACF 350 RA++EA RG + L EETA KYRATG+TPKK F CF Sbjct: 99 RAMVEAKRGEEILKAEETAAKYRATGTTPKKAFGCF 134 >ref|XP_012836260.1| PREDICTED: remorin-like [Erythranthe guttata] Length = 178 Score = 55.5 bits (132), Expect = 9e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACFS 347 +A IEADR +FL VEE A K+RATG PKKLFACFS Sbjct: 140 KASIEADRAGEFLTVEEVASKFRATGRIPKKLFACFS 176 >ref|XP_003556104.1| PREDICTED: remorin-like [Glycine max] gi|734390343|gb|KHN26658.1| Remorin [Glycine soja] gi|947041778|gb|KRG91502.1| hypothetical protein GLYMA_20G158200 [Glycine max] Length = 197 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACF 350 RA IEA +G DFL EETA KYRATG+ P KLF CF Sbjct: 162 RAFIEAQKGEDFLKAEETAAKYRATGTAPTKLFGCF 197 >ref|XP_014516587.1| PREDICTED: remorin-like [Vigna radiata var. radiata] Length = 202 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACF 350 RAL+EA RG + L EETA KYRATG+TPKK F CF Sbjct: 167 RALVEAKRGEEILNAEETAAKYRATGTTPKKAFGCF 202 >gb|AGR88905.1| remorin 1 [Datisca glomerata] Length = 202 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/37 (72%), Positives = 27/37 (72%) Frame = -3 Query: 457 RALIEADRGRDFLVVEETAEKYRATGSTPKKLFACFS 347 RA IEA RG D L EETA KYRATGS PKKL CFS Sbjct: 165 RAEIEAKRGEDLLKAEETAAKYRATGSAPKKLLGCFS 201