BLASTX nr result
ID: Rehmannia28_contig00049844
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00049844 (606 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21569.1| hypothetical protein MIMGU_mgv1a016952mg [Erythra... 83 2e-17 ref|XP_012856553.1| PREDICTED: uncharacterized protein LOC105975... 51 7e-06 >gb|EYU21569.1| hypothetical protein MIMGU_mgv1a016952mg [Erythranthe guttata] Length = 99 Score = 82.8 bits (203), Expect = 2e-17 Identities = 47/78 (60%), Positives = 52/78 (66%), Gaps = 3/78 (3%) Frame = +3 Query: 327 MPQDIKKCRIPNMLENGMRRKDVSMHVCSRCVAVFVVLRLVSAVWTFAAATVVKLILPWF 506 MP DIKKC P M E RRKD SMHV SRCVAV VV RLVSAVWTFAAATV+KL+ Sbjct: 1 MPLDIKKCPTPIMFEEDTRRKDASMHVYSRCVAVSVVSRLVSAVWTFAAATVLKLLAKKS 60 Query: 507 MKVWC---RCNNLYLVLM 551 ++C R L L L+ Sbjct: 61 RFLFCFLQRITRLSLTLI 78 >ref|XP_012856553.1| PREDICTED: uncharacterized protein LOC105975861 [Erythranthe guttata] Length = 54 Score = 51.2 bits (121), Expect = 7e-06 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = +2 Query: 323 MDAPGYQEMSYTEHVRKRHEEKG 391 MDAPGYQEMSYT+HVR+RHEEKG Sbjct: 1 MDAPGYQEMSYTDHVRRRHEEKG 23