BLASTX nr result
ID: Rehmannia28_contig00049841
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00049841 (309 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077204.1| PREDICTED: peroxidase 5-like [Sesamum indicum] 63 7e-10 ref|XP_012834560.1| PREDICTED: peroxidase 5-like [Erythranthe gu... 63 1e-09 ref|XP_011077167.1| PREDICTED: peroxidase 5-like [Sesamum indicu... 63 2e-09 ref|XP_012834612.1| PREDICTED: peroxidase 5-like [Erythranthe gu... 62 4e-09 ref|XP_011077202.1| PREDICTED: peroxidase 5-like [Sesamum indicum] 62 5e-09 ref|XP_011077203.1| PREDICTED: peroxidase 5-like [Sesamum indicum] 62 5e-09 ref|XP_015060740.1| PREDICTED: peroxidase 5-like [Solanum pennel... 61 5e-09 ref|XP_015057942.1| PREDICTED: peroxidase 5-like [Solanum pennel... 61 5e-09 ref|XP_004249985.1| PREDICTED: peroxidase 5-like [Solanum lycope... 61 5e-09 ref|XP_004249984.1| PREDICTED: peroxidase 5-like [Solanum lycope... 61 5e-09 ref|XP_012834610.1| PREDICTED: peroxidase 5-like, partial [Eryth... 61 7e-09 gb|EYU39445.1| hypothetical protein MIMGU_mgv11b018535mg, partia... 61 7e-09 ref|XP_009335532.1| PREDICTED: peroxidase 5-like [Pyrus x bretsc... 60 1e-08 ref|XP_009365500.1| PREDICTED: peroxidase 5-like [Pyrus x bretsc... 60 1e-08 ref|XP_008388923.1| PREDICTED: peroxidase 5-like [Malus domestica] 60 1e-08 ref|XP_006361498.1| PREDICTED: peroxidase 5-like [Solanum tubero... 60 2e-08 ref|XP_015163528.1| PREDICTED: peroxidase 5-like [Solanum tubero... 60 2e-08 ref|XP_006361497.1| PREDICTED: peroxidase 5-like [Solanum tubero... 60 2e-08 ref|XP_010941488.1| PREDICTED: peroxidase 5-like [Elaeis guineen... 59 5e-08 emb|CAN68183.1| hypothetical protein VITISV_028562 [Vitis vinifera] 59 5e-08 >ref|XP_011077204.1| PREDICTED: peroxidase 5-like [Sesamum indicum] Length = 223 Score = 62.8 bits (151), Expect = 7e-10 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 +VW KKF AAMVRMGNI+VLTGK GEIR+NCR +N Sbjct: 189 NVWAKKFAAAMVRMGNIEVLTGKQGEIRRNCRVVN 223 >ref|XP_012834560.1| PREDICTED: peroxidase 5-like [Erythranthe guttata] gi|604335562|gb|EYU39450.1| hypothetical protein MIMGU_mgv1a009721mg [Erythranthe guttata] Length = 333 Score = 63.2 bits (152), Expect = 1e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 SVW KKF AAMV MG+IDVLTGK GEIRKNCR +N Sbjct: 299 SVWAKKFAAAMVHMGSIDVLTGKQGEIRKNCRLVN 333 >ref|XP_011077167.1| PREDICTED: peroxidase 5-like [Sesamum indicum] gi|747061402|ref|XP_011077168.1| PREDICTED: peroxidase 5-like [Sesamum indicum] gi|747108241|ref|XP_011069438.1| PREDICTED: peroxidase 5-like [Sesamum indicum] Length = 327 Score = 62.8 bits (151), Expect = 2e-09 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 +VW KKF AAMVRMGNI+VLTGK GEIR+NCR +N Sbjct: 293 NVWAKKFAAAMVRMGNIEVLTGKQGEIRRNCRVVN 327 >ref|XP_012834612.1| PREDICTED: peroxidase 5-like [Erythranthe guttata] gi|604335556|gb|EYU39444.1| hypothetical protein MIMGU_mgv1a009735mg [Erythranthe guttata] Length = 333 Score = 61.6 bits (148), Expect = 4e-09 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 SVW KKF AAMV MG+I+VLTGK GEIRKNCR +N Sbjct: 299 SVWAKKFAAAMVHMGSIEVLTGKQGEIRKNCRLVN 333 >ref|XP_011077202.1| PREDICTED: peroxidase 5-like [Sesamum indicum] Length = 429 Score = 61.6 bits (148), Expect = 5e-09 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 SVW KKF AAMV MG+IDVLTGK GEIR+NCR +N Sbjct: 395 SVWAKKFAAAMVHMGSIDVLTGKKGEIRRNCRVVN 429 >ref|XP_011077203.1| PREDICTED: peroxidase 5-like [Sesamum indicum] Length = 463 Score = 61.6 bits (148), Expect = 5e-09 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 SVW KKF AAMV MG+IDVLTGK GEIR+NCR +N Sbjct: 429 SVWAKKFAAAMVHMGSIDVLTGKKGEIRRNCRVVN 463 >ref|XP_015060740.1| PREDICTED: peroxidase 5-like [Solanum pennellii] Length = 332 Score = 61.2 bits (147), Expect = 5e-09 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 S+W +KF AAM+ MG IDVLTG+NGEIR+NC F+N Sbjct: 298 SIWSRKFAAAMIHMGTIDVLTGRNGEIRRNCHFVN 332 >ref|XP_015057942.1| PREDICTED: peroxidase 5-like [Solanum pennellii] Length = 332 Score = 61.2 bits (147), Expect = 5e-09 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 S+W +KF AAM+ MG IDVLTG+NGEIR+NC F+N Sbjct: 298 SIWSRKFAAAMIHMGTIDVLTGRNGEIRRNCHFVN 332 >ref|XP_004249985.1| PREDICTED: peroxidase 5-like [Solanum lycopersicum] Length = 332 Score = 61.2 bits (147), Expect = 5e-09 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 S+W +KF AAM+ MG IDVLTG+NGEIR+NC F+N Sbjct: 298 SIWSRKFAAAMIHMGTIDVLTGRNGEIRRNCHFVN 332 >ref|XP_004249984.1| PREDICTED: peroxidase 5-like [Solanum lycopersicum] Length = 332 Score = 61.2 bits (147), Expect = 5e-09 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 S+W +KF AAM+ MG IDVLTG+NGEIR+NC F+N Sbjct: 298 SIWSRKFAAAMIHMGTIDVLTGRNGEIRRNCHFVN 332 >ref|XP_012834610.1| PREDICTED: peroxidase 5-like, partial [Erythranthe guttata] Length = 315 Score = 60.8 bits (146), Expect = 7e-09 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -1 Query: 306 VWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN*SGV 193 VW KFGAAMV+MGNIDVLTG GE+R NCR +N GV Sbjct: 273 VWADKFGAAMVKMGNIDVLTGNQGEVRLNCRLVNTVGV 310 >gb|EYU39445.1| hypothetical protein MIMGU_mgv11b018535mg, partial [Erythranthe guttata] Length = 315 Score = 60.8 bits (146), Expect = 7e-09 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -1 Query: 306 VWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN*SGV 193 VW KFGAAMV+MGNIDVLTG GE+R NCR +N GV Sbjct: 273 VWADKFGAAMVKMGNIDVLTGNQGEVRLNCRLVNTVGV 310 >ref|XP_009335532.1| PREDICTED: peroxidase 5-like [Pyrus x bretschneideri] Length = 311 Score = 60.1 bits (144), Expect = 1e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 + W KFGAAMV+MG+IDVLTG+ GEIRKNCR +N Sbjct: 277 AAWANKFGAAMVKMGSIDVLTGRQGEIRKNCRVVN 311 >ref|XP_009365500.1| PREDICTED: peroxidase 5-like [Pyrus x bretschneideri] Length = 327 Score = 60.1 bits (144), Expect = 1e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 + W KFGAAMV+MG+IDVLTG+ GEIRKNCR +N Sbjct: 293 AAWANKFGAAMVKMGSIDVLTGRQGEIRKNCRVVN 327 >ref|XP_008388923.1| PREDICTED: peroxidase 5-like [Malus domestica] Length = 327 Score = 60.1 bits (144), Expect = 1e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 + W KFGAAMV+MG+IDVLTG+ GEIRKNCR +N Sbjct: 293 AAWANKFGAAMVKMGSIDVLTGRQGEIRKNCRVVN 327 >ref|XP_006361498.1| PREDICTED: peroxidase 5-like [Solanum tuberosum] Length = 332 Score = 59.7 bits (143), Expect = 2e-08 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 S+W +KF AAM+ MG +DVLTG+NGEIR+NC F+N Sbjct: 298 SLWSRKFAAAMIHMGTLDVLTGRNGEIRRNCHFVN 332 >ref|XP_015163528.1| PREDICTED: peroxidase 5-like [Solanum tuberosum] Length = 334 Score = 59.7 bits (143), Expect = 2e-08 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -1 Query: 306 VWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 VWGKKF AMV MG +DVLTG+ GEIRKNC F+N Sbjct: 301 VWGKKFADAMVHMGTLDVLTGRKGEIRKNCHFVN 334 >ref|XP_006361497.1| PREDICTED: peroxidase 5-like [Solanum tuberosum] Length = 335 Score = 59.7 bits (143), Expect = 2e-08 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 S+W +KF AAM+ MG +DVLTG+NGEIR+NC F+N Sbjct: 301 SLWSRKFAAAMIHMGTLDVLTGRNGEIRRNCHFVN 335 >ref|XP_010941488.1| PREDICTED: peroxidase 5-like [Elaeis guineensis] Length = 315 Score = 58.5 bits (140), Expect = 5e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 309 SVWGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 S W ++F AAMVRMGNIDVLTG GEIRKNCR +N Sbjct: 280 SKWKEEFAAAMVRMGNIDVLTGNKGEIRKNCRVVN 314 >emb|CAN68183.1| hypothetical protein VITISV_028562 [Vitis vinifera] Length = 322 Score = 58.5 bits (140), Expect = 5e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -1 Query: 303 WGKKFGAAMVRMGNIDVLTGKNGEIRKNCRFIN 205 WG KF AAMVRMG IDVLTG GEIRKNCR +N Sbjct: 290 WGNKFAAAMVRMGAIDVLTGTQGEIRKNCRVVN 322