BLASTX nr result
ID: Rehmannia28_contig00049745
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00049745 (351 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012835529.1| PREDICTED: zinc finger protein 6-like [Eryth... 63 7e-10 ref|XP_011076533.1| PREDICTED: zinc finger protein 6 [Sesamum in... 60 2e-08 gb|EYU38973.1| hypothetical protein MIMGU_mgv1a018552mg [Erythra... 57 1e-07 gb|EYU40772.1| hypothetical protein MIMGU_mgv1a026309mg [Erythra... 55 6e-07 >ref|XP_012835529.1| PREDICTED: zinc finger protein 6-like [Erythranthe guttata] Length = 216 Score = 63.2 bits (152), Expect = 7e-10 Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = +3 Query: 249 MYSMAELDYQNKPCNT-NGRLKLFGFNMTEDQQD 347 MYSMAELDYQNKPCN NGRLKLFGFNMT QQD Sbjct: 1 MYSMAELDYQNKPCNNKNGRLKLFGFNMTHHQQD 34 >ref|XP_011076533.1| PREDICTED: zinc finger protein 6 [Sesamum indicum] Length = 231 Score = 59.7 bits (143), Expect = 2e-08 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 4/37 (10%) Frame = +3 Query: 249 MYSMAELDYQNKPCN---TNGRLKLFGFNM-TEDQQD 347 MYSMAELDYQNKPCN NGRLKLFGFNM TEDQ++ Sbjct: 1 MYSMAELDYQNKPCNNSTANGRLKLFGFNMSTEDQEE 37 >gb|EYU38973.1| hypothetical protein MIMGU_mgv1a018552mg [Erythranthe guttata] Length = 213 Score = 57.0 bits (136), Expect = 1e-07 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 1/31 (3%) Frame = +3 Query: 258 MAELDYQNKPCNT-NGRLKLFGFNMTEDQQD 347 MAELDYQNKPCN NGRLKLFGFNMT QQD Sbjct: 1 MAELDYQNKPCNNKNGRLKLFGFNMTHHQQD 31 >gb|EYU40772.1| hypothetical protein MIMGU_mgv1a026309mg [Erythranthe guttata] Length = 198 Score = 55.1 bits (131), Expect = 6e-07 Identities = 26/31 (83%), Positives = 26/31 (83%), Gaps = 1/31 (3%) Frame = +3 Query: 258 MAELDYQNKPCNT-NGRLKLFGFNMTEDQQD 347 MAELDYQNKPCN NGRLKLFGFNMT QD Sbjct: 1 MAELDYQNKPCNNKNGRLKLFGFNMTHHHQD 31