BLASTX nr result
ID: Rehmannia28_contig00049673
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00049673 (359 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012829194.1| PREDICTED: putative late blight resistance p... 60 3e-08 gb|EYU17690.1| hypothetical protein MIMGU_mgv1a023002mg [Erythra... 60 3e-08 gb|EYU23543.1| hypothetical protein MIMGU_mgv1a022015mg [Erythra... 59 7e-08 ref|XP_012853780.1| PREDICTED: putative late blight resistance p... 59 7e-08 gb|EYU23538.1| hypothetical protein MIMGU_mgv1a020112mg, partial... 56 3e-07 ref|XP_012853778.1| PREDICTED: probable disease resistance prote... 56 4e-07 gb|EYU17740.1| hypothetical protein MIMGU_mgv1a018663mg [Erythra... 53 8e-06 >ref|XP_012829194.1| PREDICTED: putative late blight resistance protein homolog R1A-4 [Erythranthe guttata] Length = 888 Score = 60.1 bits (144), Expect = 3e-08 Identities = 36/66 (54%), Positives = 46/66 (69%), Gaps = 7/66 (10%) Frame = +1 Query: 178 SYAAVISLKQTIVRLLNSCHISIL------IGFAYNEVMSLQQLLKRLDNSR-SNNEKVH 336 +YAAVISLKQTI RLLNS IS++ I AY V SLQ+ LKR D+ + +NNE+V+ Sbjct: 2 AYAAVISLKQTIERLLNSSQISLVPPSKKFIKSAYKHVQSLQEALKRFDSCKNNNNERVN 61 Query: 337 VLDGQI 354 LD +I Sbjct: 62 ALDDEI 67 >gb|EYU17690.1| hypothetical protein MIMGU_mgv1a023002mg [Erythranthe guttata] Length = 908 Score = 60.1 bits (144), Expect = 3e-08 Identities = 36/66 (54%), Positives = 46/66 (69%), Gaps = 7/66 (10%) Frame = +1 Query: 178 SYAAVISLKQTIVRLLNSCHISIL------IGFAYNEVMSLQQLLKRLDNSR-SNNEKVH 336 +YAAVISLKQTI RLLNS IS++ I AY V SLQ+ LKR D+ + +NNE+V+ Sbjct: 2 AYAAVISLKQTIERLLNSSQISLVPPSKKFIKSAYKHVQSLQEALKRFDSCKNNNNERVN 61 Query: 337 VLDGQI 354 LD +I Sbjct: 62 ALDDEI 67 >gb|EYU23543.1| hypothetical protein MIMGU_mgv1a022015mg [Erythranthe guttata] Length = 834 Score = 58.9 bits (141), Expect = 7e-08 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 7/67 (10%) Frame = +1 Query: 178 SYAAVISLKQTIVRLLNSCHISI------LIGFAYNEVMSLQQLLKRLDN-SRSNNEKVH 336 +YAAVISLK I RLL S IS +I AY +++SLQ++LKR DN SR ++E+V+ Sbjct: 2 AYAAVISLKTVIERLLKSSEISFVPPSKKIIKSAYKQLLSLQEVLKRFDNRSRISSERVN 61 Query: 337 VLDGQIR 357 LDG+IR Sbjct: 62 ALDGEIR 68 >ref|XP_012853780.1| PREDICTED: putative late blight resistance protein homolog R1A-4 [Erythranthe guttata] Length = 849 Score = 58.9 bits (141), Expect = 7e-08 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 7/67 (10%) Frame = +1 Query: 178 SYAAVISLKQTIVRLLNSCHISI------LIGFAYNEVMSLQQLLKRLDN-SRSNNEKVH 336 +YAAVISLK I RLL S IS +I AY +++SLQ++LKR DN SR ++E+V+ Sbjct: 2 AYAAVISLKTVIERLLKSSEISFVPPSKKIIKSAYKQLLSLQEVLKRFDNRSRISSERVN 61 Query: 337 VLDGQIR 357 LDG+IR Sbjct: 62 ALDGEIR 68 >gb|EYU23538.1| hypothetical protein MIMGU_mgv1a020112mg, partial [Erythranthe guttata] Length = 225 Score = 56.2 bits (134), Expect = 3e-07 Identities = 32/67 (47%), Positives = 47/67 (70%), Gaps = 7/67 (10%) Frame = +1 Query: 178 SYAAVISLKQTIVRLLNSCHISI------LIGFAYNEVMSLQQLLKRLDN-SRSNNEKVH 336 +YAA+ISLK I RLL S IS ++ +Y +++SLQ++LKR DN SR ++E+V+ Sbjct: 2 AYAALISLKSVIERLLKSSEISFVPPSKKILKSSYKQLLSLQEVLKRFDNSSRISSERVN 61 Query: 337 VLDGQIR 357 LDG+IR Sbjct: 62 ALDGEIR 68 >ref|XP_012853778.1| PREDICTED: probable disease resistance protein At1g59620 [Erythranthe guttata] Length = 262 Score = 56.2 bits (134), Expect = 4e-07 Identities = 32/67 (47%), Positives = 47/67 (70%), Gaps = 7/67 (10%) Frame = +1 Query: 178 SYAAVISLKQTIVRLLNSCHISI------LIGFAYNEVMSLQQLLKRLDN-SRSNNEKVH 336 +YAA+ISLK I RLL S IS ++ +Y +++SLQ++LKR DN SR ++E+V+ Sbjct: 2 AYAALISLKSVIERLLKSSEISFVPPSKKILKSSYKQLLSLQEVLKRFDNSSRISSERVN 61 Query: 337 VLDGQIR 357 LDG+IR Sbjct: 62 ALDGEIR 68 >gb|EYU17740.1| hypothetical protein MIMGU_mgv1a018663mg [Erythranthe guttata] Length = 854 Score = 53.1 bits (126), Expect = 8e-06 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 9/69 (13%) Frame = +1 Query: 178 SYAAVISLKQTIVRLLNSCHISI-------LIGFAYNEVMSLQQLLKRLDNSRSN--NEK 330 +YAAVISLKQTI RL+N H S+ ++ Y EV SLQ++L+ LD S + E+ Sbjct: 2 AYAAVISLKQTIDRLVNPSHTSMVQYSSPEIMKILYEEVRSLQEVLEGLDKSIGSICMER 61 Query: 331 VHVLDGQIR 357 ++ LDGQIR Sbjct: 62 MNTLDGQIR 70