BLASTX nr result
ID: Rehmannia28_contig00049629
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00049629 (415 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75728.1| hypothetical protein VITISV_031408 [Vitis vinifera] 80 4e-15 emb|CAN83839.1| hypothetical protein VITISV_023230 [Vitis vinifera] 80 7e-15 gb|KYP53274.1| Retrovirus-related Pol polyprotein from transposo... 79 1e-14 gb|KYP48079.1| Retrovirus-related Pol polyprotein from transposo... 77 4e-14 gb|KYP34577.1| Retrovirus-related Pol polyprotein from transposo... 77 6e-14 gb|KYP34572.1| Retrovirus-related Pol polyprotein from transposo... 77 6e-14 gb|KYP41981.1| Retrovirus-related Pol polyprotein from transposo... 77 8e-14 gb|KYP75416.1| Retrovirus-related Pol polyprotein from transposo... 76 2e-13 gb|KYP47805.1| Retrovirus-related Pol polyprotein from transposo... 75 2e-13 emb|CAN78509.1| hypothetical protein VITISV_031642 [Vitis vinifera] 75 2e-13 gb|KYP67039.1| Retrovirus-related Pol polyprotein from transposo... 75 3e-13 gb|KYP61342.1| Retrovirus-related Pol polyprotein from transposo... 75 3e-13 gb|KYP40443.1| Retrovirus-related Pol polyprotein from transposo... 74 5e-13 gb|KYP78233.1| Retrovirus-related Pol polyprotein from transposo... 74 5e-13 gb|KYP65286.1| Retrovirus-related Pol polyprotein from transposo... 74 6e-13 gb|KYP61341.1| Retrovirus-related Pol polyprotein from transposo... 74 6e-13 ref|XP_015386863.1| PREDICTED: uncharacterized protein LOC107177... 74 6e-13 gb|KYP46257.1| Retrovirus-related Pol polyprotein from transposo... 74 6e-13 gb|KYP75335.1| Retrovirus-related Pol polyprotein from transposo... 74 7e-13 ref|XP_015934891.1| PREDICTED: uncharacterized protein LOC107460... 74 8e-13 >emb|CAN75728.1| hypothetical protein VITISV_031408 [Vitis vinifera] Length = 1099 Score = 80.5 bits (197), Expect = 4e-15 Identities = 32/52 (61%), Positives = 44/52 (84%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTL 157 YN+ K +RS KC+FLGYSP HKGY+CL+ SG+I +A+++ FNE++FPYSTL Sbjct: 484 YNSHKFSFRSTKCLFLGYSPXHKGYRCLSXSGQIYVAKSITFNENDFPYSTL 535 >emb|CAN83839.1| hypothetical protein VITISV_023230 [Vitis vinifera] Length = 731 Score = 79.7 bits (195), Expect = 7e-15 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTL 157 YN+ KL +RS KC+FLGYS HKGY CL P GKI I+R V FNEHEFPYS L Sbjct: 106 YNSHKLQFRSSKCLFLGYSSTHKGYLCLHPFGKIYISRNVIFNEHEFPYSEL 157 >gb|KYP53274.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 839 Score = 79.0 bits (193), Expect = 1e-14 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN +KL +RS +CVFLGYS HKGYKCLAPSG++ I++ V F E+ FPY TLF Sbjct: 387 YNKTKLQFRSQECVFLGYSTSHKGYKCLAPSGRVFISKDVIFCENRFPYPTLF 439 >gb|KYP48079.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 302 Score = 76.6 bits (187), Expect = 4e-14 Identities = 34/53 (64%), Positives = 40/53 (75%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN KL +RS +CVFLGYS HKGYKCL+P GKI I++ V FNE+ FPY LF Sbjct: 247 YNKHKLDFRSHECVFLGYSTSHKGYKCLSPIGKIFISKDVVFNEYRFPYHELF 299 >gb|KYP34577.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 661 Score = 77.0 bits (188), Expect = 6e-14 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN +KL +RS +CVFLGYS HKGYKCLAPSG+I I++ V F E+ FPY ++F Sbjct: 352 YNKTKLQFRSQECVFLGYSTSHKGYKCLAPSGRIFISKDVIFCENHFPYPSMF 404 >gb|KYP34572.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 682 Score = 77.0 bits (188), Expect = 6e-14 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN +KL +RS +CVFLGYS HKGYKCLAPSG+I I++ V F E+ FPY ++F Sbjct: 373 YNKTKLQFRSQECVFLGYSTSHKGYKCLAPSGRIFISKDVIFCENHFPYPSMF 425 >gb|KYP41981.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 498 Score = 76.6 bits (187), Expect = 8e-14 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YNN KL + S +CVFLGYS HKGYKCL+P+G+I I++ V FNE+ FPY LF Sbjct: 177 YNNHKLNFSSHECVFLGYSSSHKGYKCLSPTGRIFISKDVVFNEYRFPYYDLF 229 >gb|KYP75416.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 785 Score = 75.9 bits (185), Expect = 2e-13 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN +KL +RS +CVFLGYS HKGYKCLAP+G+I I++ V F E FPY +LF Sbjct: 640 YNKNKLQFRSQECVFLGYSTSHKGYKCLAPTGRIFISKDVVFCETRFPYPSLF 692 >gb|KYP47805.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 555 Score = 75.5 bits (184), Expect = 2e-13 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN SKL RS +C+FLGYS HKGYKCLA +G++ I++ V FNE +FPY TLF Sbjct: 396 YNKSKLQLRSQECLFLGYSTSHKGYKCLAANGRLYISKDVIFNEVKFPYKTLF 448 >emb|CAN78509.1| hypothetical protein VITISV_031642 [Vitis vinifera] Length = 722 Score = 75.5 bits (184), Expect = 2e-13 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN+ K ++S KC+FLGYSP H GY+C + S +I +A+ V FNE++FPYSTLF Sbjct: 510 YNSHKFSFKSTKCLFLGYSPAHNGYRCFSSSNRIYVAKLVTFNENDFPYSTLF 562 >gb|KYP67039.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1279 Score = 75.1 bits (183), Expect = 3e-13 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 Y + KL +RS +CVFLGYS HKGYKCL+ SG+I I++ V FNEH FPY+ LF Sbjct: 599 YASHKLNFRSQECVFLGYSNSHKGYKCLSSSGRIYISKDVIFNEHRFPYTDLF 651 >gb|KYP61342.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1358 Score = 75.1 bits (183), Expect = 3e-13 Identities = 33/53 (62%), Positives = 41/53 (77%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 Y + KL +RS +CVFLGYS HKGYKCL+ SG+I I++ V FNEH FPY+ LF Sbjct: 678 YASHKLNFRSQECVFLGYSNSHKGYKCLSSSGRIYISKDVIFNEHRFPYTDLF 730 >gb|KYP40443.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 488 Score = 74.3 bits (181), Expect = 5e-13 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN K+ RS +CVFLGYSP HKGYKCL+ SG+I I++ V FNE FPY+ LF Sbjct: 236 YNQHKIQPRSEECVFLGYSPSHKGYKCLSRSGRIYISKDVIFNEGRFPYNDLF 288 >gb|KYP78233.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 540 Score = 74.3 bits (181), Expect = 5e-13 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN +KL RS +C+FLGYS HKGYKCLA G++ I++ V FNE +FPY TLF Sbjct: 126 YNRTKLQLRSQECLFLGYSTSHKGYKCLAADGRLYISKDVIFNEAKFPYKTLF 178 >gb|KYP65286.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 904 Score = 74.3 bits (181), Expect = 6e-13 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN K+ RS +CVFLGYSP HKGYKCL+ SG+I I++ V FNE FPY+ LF Sbjct: 705 YNQHKIQPRSEECVFLGYSPSHKGYKCLSRSGRIYISKDVIFNEGRFPYNDLF 757 >gb|KYP61341.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1073 Score = 74.3 bits (181), Expect = 6e-13 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN KL +RS +CVFLGYS HKGYKCLA G++ I++ V FNE +FPY LF Sbjct: 401 YNKHKLQFRSQECVFLGYSTSHKGYKCLAADGRLYISKDVVFNETKFPYKDLF 453 >ref|XP_015386863.1| PREDICTED: uncharacterized protein LOC107177515 [Citrus sinensis] Length = 1143 Score = 74.3 bits (181), Expect = 6e-13 Identities = 33/53 (62%), Positives = 38/53 (71%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN K + + KCVFLGYSP HKGYKCL PSG+ IA V F+E FPYS+LF Sbjct: 775 YNKHKFQFHTSKCVFLGYSPLHKGYKCLHPSGRTYIASHVLFDESSFPYSSLF 827 >gb|KYP46257.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1408 Score = 74.3 bits (181), Expect = 6e-13 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN KL +RS +CVFLGYS HKGYKCLA G++ I++ V FNE +FPY LF Sbjct: 736 YNKHKLQFRSQECVFLGYSTSHKGYKCLAADGRLYISKDVVFNETKFPYKDLF 788 >gb|KYP75335.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 537 Score = 73.9 bits (180), Expect = 7e-13 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 YN +KL RS +CVFLGYS HKGYKCLAP+G+I I++ V F E FPY +LF Sbjct: 276 YNKNKLQLRSQECVFLGYSTSHKGYKCLAPTGRIFISKDVIFCETRFPYPSLF 328 >ref|XP_015934891.1| PREDICTED: uncharacterized protein LOC107460974 [Arachis duranensis] Length = 873 Score = 73.9 bits (180), Expect = 8e-13 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = +2 Query: 2 YNNSKLMYRSLKCVFLGYSPHHKGYKCLAPSGKIVIARTVAFNEHEFPYSTLF 160 Y K +++ KC+FLGYSP+HKGYKCL PS K +AR V F+E EFPY +LF Sbjct: 491 YRPHKFYFKTHKCLFLGYSPYHKGYKCLCPSEKFYVARHVVFDESEFPYQSLF 543