BLASTX nr result
ID: Rehmannia28_contig00049514
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00049514 (608 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EGN91373.1| hypothetical protein SERLA73DRAFT_67532, partial ... 79 5e-16 ref|XP_013238305.1| hypothetical protein DI09_258p10 [Mitosporid... 74 1e-12 gb|KII82820.1| hypothetical protein PLICRDRAFT_120235, partial [... 67 7e-12 ref|XP_007335614.1| hypothetical protein AGABI1DRAFT_49288, part... 67 7e-12 ref|XP_003851059.1| hypothetical protein MYCGRDRAFT_45280 [Zymos... 66 2e-11 ref|XP_009539721.1| hypothetical protein PHYSODRAFT_535525, part... 65 5e-11 gb|ETX03503.1| hypothetical protein ETSY1_47025 (plasmid) [Candi... 55 3e-07 ref|XP_002488936.1| hypothetical protein SORBIDRAFT_1514s002010 ... 55 4e-07 ref|XP_002449484.1| hypothetical protein SORBIDRAFT_05g016450 [S... 55 4e-07 gb|EMF07909.1| hypothetical protein SEPMUDRAFT_55166 [Sphaerulin... 55 4e-07 ref|WP_016885142.1| MULTISPECIES: hypothetical protein [Bacteria] 55 4e-07 ref|WP_045623793.1| hypothetical protein [Vibrio vulnificus] gi|... 55 4e-07 ref|WP_046876397.1| hypothetical protein, partial [Vibrio paraha... 55 5e-07 ref|XP_003666594.1| hypothetical protein MYCTH_2071285 [Myceliop... 54 1e-06 gb|EMS64240.1| hypothetical protein TRIUR3_08371 [Triticum urartu] 53 2e-06 ref|XP_001893676.1| hypothetical protein Bm1_11025 [Brugia malayi] 54 3e-06 gb|EMS62447.1| hypothetical protein TRIUR3_00139 [Triticum urartu] 52 5e-06 gb|KUJ06144.1| hypothetical protein LY89DRAFT_603785 [Phialoceph... 52 5e-06 ref|XP_001892586.1| hypothetical protein Bm1_05560 [Brugia malayi] 52 8e-06 >gb|EGN91373.1| hypothetical protein SERLA73DRAFT_67532, partial [Serpula lacrymans var. lacrymans S7.3] Length = 91 Score = 79.0 bits (193), Expect = 5e-16 Identities = 43/87 (49%), Positives = 50/87 (57%) Frame = +1 Query: 1 VKLSRRFHAWWCPSVNSFKFRPCDYTPPRTHTFLISLKRLRESSLRGNRSPPHYNLISFL 180 VKLSRR H+WWCPSVNSFKF+PCD+TPP LIS K +S RG P ++L+ L Sbjct: 17 VKLSRRLHSWWCPSVNSFKFQPCDHTPPTNPKTLISRKVPNNTSKRGCPIPSRHSLLLRL 76 Query: 181 PSXXXXXXXXXXXXXXIVFDPPTIVLD 261 IVFDP T VLD Sbjct: 77 ------------QRYLIVFDPLTFVLD 91 >ref|XP_013238305.1| hypothetical protein DI09_258p10 [Mitosporidium daphniae] gi|692169256|gb|KGG51869.1| hypothetical protein DI09_258p10 [Mitosporidium daphniae] Length = 263 Score = 74.3 bits (181), Expect = 1e-12 Identities = 51/109 (46%), Positives = 57/109 (52%) Frame = -1 Query: 329 EVKFLDCLKMNDSEGILQWYASQSRTIVGGSKTIRYRRSFNCKRYRLRDGRKEIRL**GG 150 EVKFLD K N E I Q + GSKTIRYRRS N K RL G++ + Sbjct: 157 EVKFLDFQKTNYCESICQGFK--------GSKTIRYRRSLNHKPCRLGIGQRRV------ 202 Query: 149 ERLPLNDDSLRRLREIKNVCVLGGV*SQGRNLNELTEGHHQAWNLRLNL 3 D + LREIK SQ RNL ELTEGHHQ W+LRLNL Sbjct: 203 -------DLIGTLREIK---------SQDRNLKELTEGHHQEWSLRLNL 235 >gb|KII82820.1| hypothetical protein PLICRDRAFT_120235, partial [Plicaturopsis crispa FD-325 SS-3] gi|749757595|gb|KII82847.1| hypothetical protein PLICRDRAFT_120174, partial [Plicaturopsis crispa FD-325 SS-3] Length = 49 Score = 67.0 bits (162), Expect = 7e-12 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 VKLSRRFHAWWCPSVNSFKFRPCDYTPPRT 90 VKLSRR H WWCPSVNSFKF+PCD+TPPRT Sbjct: 17 VKLSRRLHTWWCPSVNSFKFQPCDHTPPRT 46 >ref|XP_007335614.1| hypothetical protein AGABI1DRAFT_49288, partial [Agaricus bisporus var. burnettii JB137-S8] gi|409072659|gb|EKM73747.1| hypothetical protein AGABI1DRAFT_49288, partial [Agaricus bisporus var. burnettii JB137-S8] Length = 49 Score = 67.0 bits (162), Expect = 7e-12 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 VKLSRRFHAWWCPSVNSFKFRPCDYTPPRT 90 VKLSRR H WWCPSVNSFKF+PCD+TPPRT Sbjct: 17 VKLSRRLHTWWCPSVNSFKFQPCDHTPPRT 46 >ref|XP_003851059.1| hypothetical protein MYCGRDRAFT_45280 [Zymoseptoria tritici IPO323] gi|339470938|gb|EGP86035.1| hypothetical protein MYCGRDRAFT_45280 [Zymoseptoria tritici IPO323] gi|452836072|gb|EME38021.1| hypothetical protein DOTSEDRAFT_67407 [Dothistroma septosporum NZE10] Length = 55 Score = 66.2 bits (160), Expect = 2e-11 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 VKLSRRFHAWWCPSVNSFKFRPCDYTPPRT 90 VKLSRR HAWWCPSVN FKF+PCD+TPPRT Sbjct: 23 VKLSRRLHAWWCPSVNFFKFQPCDHTPPRT 52 >ref|XP_009539721.1| hypothetical protein PHYSODRAFT_535525, partial [Phytophthora sojae] gi|348665043|gb|EGZ04879.1| hypothetical protein PHYSODRAFT_535525, partial [Phytophthora sojae] Length = 49 Score = 64.7 bits (156), Expect = 5e-11 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 VKLSRRFHAWWCPSVNSFKFRPCDYTPPRT 90 VKLSRR H+WWCPSVNSFKF+PCD+TPP T Sbjct: 17 VKLSRRLHSWWCPSVNSFKFQPCDHTPPGT 46 >gb|ETX03503.1| hypothetical protein ETSY1_47025 (plasmid) [Candidatus Entotheonella sp. TSY1] Length = 68 Score = 55.5 bits (132), Expect = 3e-07 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = -3 Query: 357 SGGSLYLDVRGEILGLSEDERQRRHSSMVCQSIKNDSWRIEDDQIPS 217 S G YL VRGEILG +DE+ R+H + IKN+SW EDDQIPS Sbjct: 22 SWGHSYLIVRGEILGFMKDEQVRKHLPRMFSLIKNESWGFEDDQIPS 68 >ref|XP_002488936.1| hypothetical protein SORBIDRAFT_1514s002010 [Sorghum bicolor] gi|253759636|ref|XP_002488938.1| hypothetical protein SORBIDRAFT_1506s002010 [Sorghum bicolor] gi|253759935|ref|XP_002488954.1| hypothetical protein SORBIDRAFT_1236s002010 [Sorghum bicolor] gi|253759972|ref|XP_002488957.1| hypothetical protein SORBIDRAFT_1205s002020 [Sorghum bicolor] gi|253760151|ref|XP_002488969.1| hypothetical protein SORBIDRAFT_1050s002020 [Sorghum bicolor] gi|253760863|ref|XP_002489025.1| hypothetical protein SORBIDRAFT_0450s002020 [Sorghum bicolor] gi|253761034|ref|XP_002489038.1| hypothetical protein SORBIDRAFT_0304s002010 [Sorghum bicolor] gi|297836874|ref|XP_002886319.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|219887055|gb|ACL53902.1| unknown [Zea mays] gi|241946941|gb|EES20086.1| hypothetical protein SORBIDRAFT_1050s002020 [Sorghum bicolor] gi|241947045|gb|EES20190.1| hypothetical protein SORBIDRAFT_1205s002020 [Sorghum bicolor] gi|241947052|gb|EES20197.1| hypothetical protein SORBIDRAFT_1236s002010 [Sorghum bicolor] gi|241947162|gb|EES20307.1| hypothetical protein SORBIDRAFT_1506s002010 [Sorghum bicolor] gi|241947163|gb|EES20308.1| hypothetical protein SORBIDRAFT_1514s002010 [Sorghum bicolor] gi|241947314|gb|EES20459.1| hypothetical protein SORBIDRAFT_0304s002010 [Sorghum bicolor] gi|241947338|gb|EES20483.1| hypothetical protein SORBIDRAFT_0450s002020 [Sorghum bicolor] gi|297332159|gb|EFH62578.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|902197674|gb|KNA13494.1| hypothetical protein SOVF_116400 [Spinacia oleracea] Length = 52 Score = 54.7 bits (130), Expect = 4e-07 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = -3 Query: 357 SGGSLYLDVRGEILGLSEDERQRRHSSMVCQSIKNDSWRIEDDQIPS 217 S G Y VRGEILG +DE+ R+H + IKN+SW +EDDQIPS Sbjct: 6 SRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESWGLEDDQIPS 52 >ref|XP_002449484.1| hypothetical protein SORBIDRAFT_05g016450 [Sorghum bicolor] Length = 52 Score = 54.7 bits (130), Expect = 4e-07 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = -3 Query: 357 SGGSLYLDVRGEILGLSEDERQRRHSSMVCQSIKNDSWRIEDDQIPS 217 S G Y VRGEILG +DE+ R+H + IKN+SW +EDDQIPS Sbjct: 6 SWGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESWGLEDDQIPS 52 >gb|EMF07909.1| hypothetical protein SEPMUDRAFT_55166 [Sphaerulina musiva SO2202] Length = 54 Score = 54.7 bits (130), Expect = 4e-07 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = +1 Query: 16 RFHAWWCPSVNSFKFRPCDYTPPRT 90 R +AWWCPSVN FKF+PCD+TPPRT Sbjct: 27 RVNAWWCPSVNFFKFQPCDHTPPRT 51 >ref|WP_016885142.1| MULTISPECIES: hypothetical protein [Bacteria] Length = 59 Score = 54.7 bits (130), Expect = 4e-07 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = -3 Query: 357 SGGSLYLDVRGEILGLSEDERQRRHSSMVCQSIKNDSWRIEDDQIPS 217 S G Y VRGEILG +DE+ R+H + IKN+SW +EDDQIPS Sbjct: 13 SRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESWGLEDDQIPS 59 >ref|WP_045623793.1| hypothetical protein [Vibrio vulnificus] gi|974706164|emb|CUW79419.1| conserved hypothetical protein [Escherichia coli] Length = 60 Score = 54.7 bits (130), Expect = 4e-07 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = -3 Query: 357 SGGSLYLDVRGEILGLSEDERQRRHSSMVCQSIKNDSWRIEDDQIPS 217 S G Y VRGEILG +DE+ R+H + IKN+SW +EDDQIPS Sbjct: 14 SRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESWGLEDDQIPS 60 >ref|WP_046876397.1| hypothetical protein, partial [Vibrio parahaemolyticus] gi|821242584|gb|KKZ05227.1| hypothetical protein YC68_24375, partial [Vibrio parahaemolyticus] Length = 66 Score = 54.7 bits (130), Expect = 5e-07 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = -3 Query: 357 SGGSLYLDVRGEILGLSEDERQRRHSSMVCQSIKNDSWRIEDDQIPS 217 S G Y VRGEILG +DE+ R+H + IKN+SW +EDDQIPS Sbjct: 20 SRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESWGLEDDQIPS 66 >ref|XP_003666594.1| hypothetical protein MYCTH_2071285 [Myceliophthora thermophila ATCC 42464] gi|347013867|gb|AEO61349.1| hypothetical protein MYCTH_2071285 [Myceliophthora thermophila ATCC 42464] Length = 56 Score = 53.5 bits (127), Expect = 1e-06 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = +1 Query: 22 HAWWCPSVNSFKFRPCDYTPPRTHTF 99 H WWCPSVN FKF+PCD+TPP TF Sbjct: 31 HPWWCPSVNFFKFQPCDHTPPGAQTF 56 >gb|EMS64240.1| hypothetical protein TRIUR3_08371 [Triticum urartu] Length = 52 Score = 52.8 bits (125), Expect = 2e-06 Identities = 25/47 (53%), Positives = 31/47 (65%) Frame = -3 Query: 357 SGGSLYLDVRGEILGLSEDERQRRHSSMVCQSIKNDSWRIEDDQIPS 217 S G Y VRGEILG +DE+ R+H + IKN+ W +EDDQIPS Sbjct: 6 SRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNERWGLEDDQIPS 52 >ref|XP_001893676.1| hypothetical protein Bm1_11025 [Brugia malayi] Length = 96 Score = 53.5 bits (127), Expect = 3e-06 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +1 Query: 1 VKLSRRFHAWWCPSVNSFKFRPCDYTPPRT 90 VKLSRR H+WWCPSVN FKF+ C++T P T Sbjct: 23 VKLSRRLHSWWCPSVNFFKFQLCNHTSPGT 52 >gb|EMS62447.1| hypothetical protein TRIUR3_00139 [Triticum urartu] Length = 52 Score = 51.6 bits (122), Expect = 5e-06 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = -3 Query: 357 SGGSLYLDVRGEILGLSEDERQRRHSSMVCQSIKNDSWRIEDDQIPS 217 S G LY V+GEILG +DE+ R+H + I+N+SW +EDDQ PS Sbjct: 6 SRGHLYFIVKGEILGFMKDEQLRKHLPRMFSLIQNESWGLEDDQKPS 52 >gb|KUJ06144.1| hypothetical protein LY89DRAFT_603785 [Phialocephala scopiformis] Length = 55 Score = 51.6 bits (122), Expect = 5e-06 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = +1 Query: 25 AWWCPSVNSFKFRPCDYTPPRT 90 +WWCPSVN FKF+PCD+TPPRT Sbjct: 31 SWWCPSVNFFKFQPCDHTPPRT 52 >ref|XP_001892586.1| hypothetical protein Bm1_05560 [Brugia malayi] Length = 85 Score = 52.0 bits (123), Expect = 8e-06 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = +1 Query: 4 KLSRRFHAWWCPSVNSFKFRPCDYTPPRT 90 KLSRR H+WWCPSVN FKF+ C++T P T Sbjct: 13 KLSRRLHSWWCPSVNFFKFQLCNHTSPGT 41