BLASTX nr result
ID: Rehmannia28_contig00048764
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00048764 (423 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22592.1| hypothetical protein MIMGU_mgv1a024924mg [Erythra... 60 1e-16 >gb|EYU22592.1| hypothetical protein MIMGU_mgv1a024924mg [Erythranthe guttata] Length = 139 Score = 60.1 bits (144), Expect(2) = 1e-16 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +1 Query: 166 VLISFNGFVASVLPMELAWVPIVCGVLCVLPFVIAALPQDAVDKNTA 306 VL+SFNG V S LP++LAWVP++CG L VLPFV+AAL ++ +A Sbjct: 89 VLMSFNGLVGSALPVDLAWVPVLCGGLSVLPFVVAALTPPPSEETSA 135 Score = 53.1 bits (126), Expect(2) = 1e-16 Identities = 30/57 (52%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = +2 Query: 2 IAIALLITNEA-KSQTLWGRLVLTGITVGCMAIWNGISLREKFQN-AYVIENTGIVM 166 I +ALLIT KS T+ VLTG+ GC+AIWNGIS R F + A V+E GI+M Sbjct: 32 ITVALLITKGGGKSHTVLDYCVLTGLLAGCVAIWNGISFRATFPHAANVVEQLGIIM 88