BLASTX nr result
ID: Rehmannia28_contig00048702
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00048702 (392 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077383.1| PREDICTED: floral homeotic protein APETALA 2... 57 6e-07 >ref|XP_011077383.1| PREDICTED: floral homeotic protein APETALA 2-like [Sesamum indicum] Length = 471 Score = 56.6 bits (135), Expect = 6e-07 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = -2 Query: 391 TSSFTSPSAAIHRQLPPFGTRSQNHYLTPLANLNSGSH*RWR 266 TSSFTS SAAIH PF TRSQNHY P+AN N+ SH RWR Sbjct: 432 TSSFTSSSAAIHEL--PFNTRSQNHYPPPVANSNNRSHYRWR 471