BLASTX nr result
ID: Rehmannia28_contig00048634
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00048634 (466 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18584.1| hypothetical protein MIMGU_mgv1a025869mg [Erythra... 70 2e-11 ref|XP_012828188.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-11 ref|XP_011070072.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-11 ref|XP_002275537.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-10 emb|CAN83391.1| hypothetical protein VITISV_041405 [Vitis vinifera] 68 2e-10 gb|KCW51100.1| hypothetical protein EUGRSUZ_J00703, partial [Euc... 67 2e-10 ref|XP_010031730.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-10 ref|XP_015064359.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-10 ref|XP_010315549.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 67 3e-10 emb|CDP08457.1| unnamed protein product [Coffea canephora] 67 4e-10 ref|XP_004291741.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-10 ref|XP_008227721.1| PREDICTED: pentatricopeptide repeat-containi... 66 8e-10 gb|EEF35342.1| pentatricopeptide repeat-containing protein, puta... 65 1e-09 ref|XP_015579580.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-09 ref|XP_009611873.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-09 ref|XP_009601731.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 65 1e-09 ref|XP_006345300.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-09 ref|XP_015873684.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-09 ref|XP_009770754.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-09 gb|KDO44965.1| hypothetical protein CISIN_1g005487mg [Citrus sin... 64 3e-09 >gb|EYU18584.1| hypothetical protein MIMGU_mgv1a025869mg [Erythranthe guttata] Length = 630 Score = 70.5 bits (171), Expect = 2e-11 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDA 12 +AKCGAVKEA VFNQL ++DLVSWTS++VAYGSHGQAF+A Sbjct: 391 YAKCGAVKEAEAVFNQLPTKDLVSWTSMMVAYGSHGQAFEA 431 >ref|XP_012828188.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 [Erythranthe guttata] Length = 695 Score = 70.5 bits (171), Expect = 2e-11 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDA 12 +AKCGAVKEA VFNQL ++DLVSWTS++VAYGSHGQAF+A Sbjct: 456 YAKCGAVKEAEAVFNQLPTKDLVSWTSMMVAYGSHGQAFEA 496 >ref|XP_011070072.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 [Sesamum indicum] gi|747048148|ref|XP_011070073.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 [Sesamum indicum] Length = 697 Score = 70.5 bits (171), Expect = 2e-11 Identities = 31/42 (73%), Positives = 39/42 (92%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV++A +FNQL +RDLVSWTS+IVAYGSHGQAF+A+ Sbjct: 455 YAKCGAVEQAASIFNQLSTRDLVSWTSMIVAYGSHGQAFEAL 496 >ref|XP_002275537.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 [Vitis vinifera] Length = 694 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV EA+ +FNQL RD VSWTS+I AYGSHGQAF+A+ Sbjct: 454 YAKCGAVDEALHIFNQLPERDFVSWTSMIAAYGSHGQAFEAL 495 >emb|CAN83391.1| hypothetical protein VITISV_041405 [Vitis vinifera] Length = 886 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV EA+ +FNQL RD VSWTS+I AYGSHGQAF+A+ Sbjct: 646 YAKCGAVDEALHIFNQLPERDFVSWTSMIAAYGSHGQAFEAL 687 >gb|KCW51100.1| hypothetical protein EUGRSUZ_J00703, partial [Eucalyptus grandis] Length = 652 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV EAI VF QL RDL+SWTS+I AYGSHGQAF+A+ Sbjct: 432 YAKCGAVDEAIQVFKQLPKRDLMSWTSMITAYGSHGQAFEAL 473 >ref|XP_010031730.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 [Eucalyptus grandis] Length = 705 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV EAI VF QL RDL+SWTS+I AYGSHGQAF+A+ Sbjct: 452 YAKCGAVDEAIQVFKQLPKRDLMSWTSMITAYGSHGQAFEAL 493 >ref|XP_015064359.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 [Solanum pennellii] Length = 705 Score = 67.0 bits (162), Expect = 3e-10 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV EAI VF++L RDLVSWT++I AYGSHGQAF+A+ Sbjct: 452 YAKCGAVSEAIEVFDELPERDLVSWTTMIAAYGSHGQAFEAL 493 >ref|XP_010315549.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g27110 [Solanum lycopersicum] Length = 705 Score = 67.0 bits (162), Expect = 3e-10 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV EAI VF++L RDLVSWT++I AYGSHGQAF+A+ Sbjct: 452 YAKCGAVSEAIEVFDELPERDLVSWTTMIAAYGSHGQAFEAL 493 >emb|CDP08457.1| unnamed protein product [Coffea canephora] Length = 694 Score = 66.6 bits (161), Expect = 4e-10 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV E++ VFNQLR RDLVSWTS+I A+GSHGQA +A+ Sbjct: 454 YAKCGAVDESLCVFNQLRKRDLVSWTSMIGAFGSHGQAHEAL 495 >ref|XP_004291741.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X1 [Fragaria vesca subsp. vesca] gi|764545131|ref|XP_011459468.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X1 [Fragaria vesca subsp. vesca] gi|764545135|ref|XP_011459469.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like isoform X1 [Fragaria vesca subsp. vesca] Length = 703 Score = 66.2 bits (160), Expect = 6e-10 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV EA+ VFN+L SRDLVSWTS+I AYGSHGQA +A+ Sbjct: 454 YAKCGAVDEALNVFNKLPSRDLVSWTSMIAAYGSHGQAKEAL 495 >ref|XP_008227721.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 [Prunus mume] Length = 694 Score = 65.9 bits (159), Expect = 8e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV EA+ VFN+L RDLVSWTS+I AYGSHGQA +A+ Sbjct: 454 YAKCGAVDEALNVFNRLPDRDLVSWTSMITAYGSHGQALEAL 495 >gb|EEF35342.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 520 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV EA+ VFN+L RDL+SWTSII AYGSHGQA +A+ Sbjct: 378 YAKCGAVDEALSVFNKLPERDLLSWTSIISAYGSHGQALEAL 419 >ref|XP_015579580.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like [Ricinus communis] Length = 634 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV EA+ VFN+L RDL+SWTSII AYGSHGQA +A+ Sbjct: 454 YAKCGAVDEALSVFNKLPERDLLSWTSIISAYGSHGQALEAL 495 >ref|XP_009611873.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110-like [Nicotiana tomentosiformis] Length = 691 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCG V EA VF++L RDLVSWT++IVAYGSHGQAF+A+ Sbjct: 455 YAKCGVVSEAFQVFDELPERDLVSWTTMIVAYGSHGQAFEAL 496 >ref|XP_009601731.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g27110-like [Nicotiana tomentosiformis] Length = 698 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCG V EA VF++L RDLVSWT++IVAYGSHGQAF+A+ Sbjct: 445 YAKCGVVSEAFQVFDELPERDLVSWTTMIVAYGSHGQAFEAL 486 >ref|XP_006345300.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 [Solanum tuberosum] Length = 705 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV EA VF++L RDLVSWT++I AYGSHGQAF+A+ Sbjct: 452 YAKCGAVSEAFKVFDELPERDLVSWTTMIAAYGSHGQAFEAL 493 >ref|XP_015873684.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 [Ziziphus jujuba] Length = 691 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV EA+ +FN+L RD+VSWTS+I AYGSHGQA +A+ Sbjct: 454 YAKCGAVDEALDIFNRLPGRDIVSWTSMIAAYGSHGQALEAL 495 >ref|XP_009770754.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27110 [Nicotiana sylvestris] Length = 708 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCG V EA VF++L RDLVSWT++IVAYGSHGQAF+A+ Sbjct: 455 YAKCGVVSEASQVFDELPERDLVSWTTMIVAYGSHGQAFEAL 496 >gb|KDO44965.1| hypothetical protein CISIN_1g005487mg [Citrus sinensis] Length = 694 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 134 WAKCGAVKEAIVVFNQLRSRDLVSWTSIIVAYGSHGQAFDAV 9 +AKCGAV EA VFN+L RDLVSWTS+I AYGSHG+A +A+ Sbjct: 454 YAKCGAVDEAFKVFNELPERDLVSWTSMIAAYGSHGRALEAL 495