BLASTX nr result
ID: Rehmannia28_contig00048540
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00048540 (565 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085156.1| PREDICTED: transcription initiation factor T... 55 8e-06 >ref|XP_011085156.1| PREDICTED: transcription initiation factor TFIID subunit 8 [Sesamum indicum] gi|747076195|ref|XP_011085157.1| PREDICTED: transcription initiation factor TFIID subunit 8 [Sesamum indicum] Length = 262 Score = 54.7 bits (130), Expect = 8e-06 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 5/66 (7%) Frame = -3 Query: 554 KEKEDENWRFCDERKRVERVVSNKEIEISGKRGKVRFKMGVAIHNPTM-VGNLR----GA 390 +E+E+E W R+ VER +N+ ++SGKRGKVRF+MGV + N + V NLR A Sbjct: 197 EEREEEKWDC--RRETVERECNNENFQVSGKRGKVRFRMGVGLDNKVVRVRNLRVKGVTA 254 Query: 389 GTGKRV 372 G GKRV Sbjct: 255 GIGKRV 260