BLASTX nr result
ID: Rehmannia28_contig00047770
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00047770 (438 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012834727.1| PREDICTED: reticulon-like protein B22 [Eryth... 64 3e-10 ref|XP_011095970.1| PREDICTED: reticulon-like protein B22 [Sesam... 55 9e-07 >ref|XP_012834727.1| PREDICTED: reticulon-like protein B22 [Erythranthe guttata] gi|848847947|ref|XP_012834805.1| PREDICTED: reticulon-like protein B22 [Erythranthe guttata] gi|848847951|ref|XP_012834882.1| PREDICTED: reticulon-like protein B22 [Erythranthe guttata] gi|604347786|gb|EYU45941.1| hypothetical protein MIMGU_mgv1a015267mg [Erythranthe guttata] gi|604347787|gb|EYU45942.1| hypothetical protein MIMGU_mgv1a015267mg [Erythranthe guttata] Length = 163 Score = 64.3 bits (155), Expect = 3e-10 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = -3 Query: 157 SCICYPDSFLCRNWLGLSSLNAGLCLLCLYMVVENSQTNSTCLARFSGRRDA 2 SC+ Y S + R G++ GLCLLCLYMVVENS+TN+TCLARFSG+RDA Sbjct: 105 SCL-YVLSVIGRAISGVTVAYIGLCLLCLYMVVENSETNNTCLARFSGKRDA 155 >ref|XP_011095970.1| PREDICTED: reticulon-like protein B22 [Sesamum indicum] Length = 164 Score = 55.1 bits (131), Expect = 9e-07 Identities = 27/48 (56%), Positives = 31/48 (64%) Frame = -3 Query: 145 YPDSFLCRNWLGLSSLNAGLCLLCLYMVVENSQTNSTCLARFSGRRDA 2 Y S + R G++ GLCL CLY+V ENSQTN TCL R GRRDA Sbjct: 109 YVLSVIGRAISGVTVAYIGLCLFCLYLVAENSQTNDTCLGRLCGRRDA 156