BLASTX nr result
ID: Rehmannia28_contig00046243
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00046243 (446 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010101832.1| hypothetical protein L484_023622 [Morus nota... 55 3e-06 >ref|XP_010101832.1| hypothetical protein L484_023622 [Morus notabilis] gi|587901705|gb|EXB89969.1| hypothetical protein L484_023622 [Morus notabilis] Length = 756 Score = 55.5 bits (132), Expect = 3e-06 Identities = 29/65 (44%), Positives = 37/65 (56%) Frame = +1 Query: 4 PIGTDLKLNVDVAVVSEHEFIGIGAVIRDSFDVIRACVARRIYGCFEVLAAEAITLREGL 183 P+ KLN D +V IGIG VIRD ++ AC+ +RI G F AE + LREGL Sbjct: 181 PVAGLFKLNTDASVREGTSSIGIGVVIRDGDGIVCACLVKRIAGSFSPFLAECMALREGL 240 Query: 184 EFAAD 198 FA + Sbjct: 241 IFAQE 245