BLASTX nr result
ID: Rehmannia28_contig00046241
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00046241 (949 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF35482.1| conserved hypothetical protein [Ricinus communis] 58 5e-06 >gb|EEF35482.1| conserved hypothetical protein [Ricinus communis] Length = 335 Score = 57.8 bits (138), Expect = 5e-06 Identities = 23/50 (46%), Positives = 32/50 (64%) Frame = +3 Query: 3 YVCGLLGHTKKDCEVLDGNDEYAQISEDSLPYGDWLRASPMKKHAAIVSE 152 YVCG LGH +DC+ +D Y + E LP+GDW+RASP K+ I+ + Sbjct: 74 YVCGCLGHVMRDCDSRTEDDGYDAMDEKLLPFGDWMRASPFKRTKVIIQD 123