BLASTX nr result
ID: Rehmannia28_contig00046151
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00046151 (452 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092028.1| PREDICTED: U11/U12 small nuclear ribonucleop... 56 1e-06 >ref|XP_011092028.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 35 kDa protein [Sesamum indicum] Length = 312 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 8/50 (16%) Frame = +2 Query: 137 YSEDRLHKQHKQRSHSHRHEK-------RSYD-VERSYRHHKDSH*HDRY 262 Y+EDR KQHKQ HS+RHEK RS+D ER+YR+HKD H HDR+ Sbjct: 254 YNEDRHQKQHKQGRHSYRHEKKPSSSRERSHDRDERAYRYHKDLHRHDRW 303