BLASTX nr result
ID: Rehmannia28_contig00044976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00044976 (455 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43116.1| hypothetical protein MIMGU_mgv1a025890mg [Erythra... 80 4e-16 ref|XP_012830422.1| PREDICTED: protein TEM1-like [Erythranthe gu... 80 2e-15 ref|XP_011079013.1| PREDICTED: septum-promoting GTP-binding prot... 70 9e-12 >gb|EYU43116.1| hypothetical protein MIMGU_mgv1a025890mg [Erythranthe guttata] Length = 182 Score = 80.1 bits (196), Expect = 4e-16 Identities = 35/52 (67%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = +3 Query: 225 IMQLCK-KTFHFNVKRKILWRISTLRRYIRSILNRFRACWIGKSSNRYRHLP 377 + Q+C+ K+FHFN+K++ILWRIS LRRY+RSI +RF ACWI KSS RYRH P Sbjct: 1 MQQICRRKSFHFNIKKRILWRISVLRRYLRSIWSRFVACWIAKSSVRYRHFP 52 >ref|XP_012830422.1| PREDICTED: protein TEM1-like [Erythranthe guttata] Length = 255 Score = 80.1 bits (196), Expect = 2e-15 Identities = 35/52 (67%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = +3 Query: 225 IMQLCK-KTFHFNVKRKILWRISTLRRYIRSILNRFRACWIGKSSNRYRHLP 377 + Q+C+ K+FHFN+K++ILWRIS LRRY+RSI +RF ACWI KSS RYRH P Sbjct: 1 MQQICRRKSFHFNIKKRILWRISVLRRYLRSIWSRFVACWIAKSSVRYRHFP 52 >ref|XP_011079013.1| PREDICTED: septum-promoting GTP-binding protein 1-like [Sesamum indicum] Length = 290 Score = 70.5 bits (171), Expect = 9e-12 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +3 Query: 231 QLCKKTFHFNVKRKILWRISTLRRYIRSILNRFRACWIGKSSNRYRHL 374 QL +K HF++KR+ILWRISTLRRY+R+ RF AC +GKSS +YRHL Sbjct: 3 QLSRKNVHFSIKRRILWRISTLRRYLRTFWRRFFACGLGKSSIKYRHL 50