BLASTX nr result
ID: Rehmannia28_contig00044872
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00044872 (373 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087551.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-10 ref|XP_012859001.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-07 >ref|XP_011087551.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Sesamum indicum] Length = 729 Score = 67.0 bits (162), Expect = 1e-10 Identities = 35/48 (72%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = +2 Query: 2 KGWVPDASTHALLMGSIASNENISRKA-KENFGIQDYVSSILEEGLGK 142 KGWVPDASTHALL+GSIA E + RK+ E F IQD VS ILEEGLGK Sbjct: 681 KGWVPDASTHALLIGSIARKEMVGRKSGSEIFSIQDNVSCILEEGLGK 728 >ref|XP_012859001.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Erythranthe guttata] Length = 727 Score = 58.5 bits (140), Expect = 1e-07 Identities = 34/49 (69%), Positives = 36/49 (73%), Gaps = 2/49 (4%) Frame = +2 Query: 2 KGWVPDASTHALLMGSIASNENISRK-AKENFGIQ-DYVSSILEEGLGK 142 KGWVP STH LLMGSIA NE +SR+ A FG Q D VS ILEEGLGK Sbjct: 678 KGWVPHGSTHVLLMGSIARNEMVSREFADGMFGKQEDSVSCILEEGLGK 726