BLASTX nr result
ID: Rehmannia28_contig00044795
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00044795 (357 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077383.1| PREDICTED: floral homeotic protein APETALA 2... 55 2e-06 >ref|XP_011077383.1| PREDICTED: floral homeotic protein APETALA 2-like [Sesamum indicum] Length = 471 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -2 Query: 356 TSSFTSPSAAIHHQLPPFSTRSQNHYLTPLANLSSGSH*RWR 231 TSSFTS SAAIH PF+TRSQNHY P+AN ++ SH RWR Sbjct: 432 TSSFTSSSAAIHEL--PFNTRSQNHYPPPVANSNNRSHYRWR 471