BLASTX nr result
ID: Rehmannia28_contig00044699
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00044699 (367 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012850398.1| PREDICTED: scarecrow-like protein 9 [Erythra... 65 4e-10 ref|XP_011077642.1| PREDICTED: scarecrow-like protein 9 [Sesamum... 60 3e-08 ref|XP_009804922.1| PREDICTED: scarecrow-like protein 9 [Nicotia... 55 2e-06 >ref|XP_012850398.1| PREDICTED: scarecrow-like protein 9 [Erythranthe guttata] gi|604313267|gb|EYU26598.1| hypothetical protein MIMGU_mgv1a001935mg [Erythranthe guttata] Length = 736 Score = 65.5 bits (158), Expect = 4e-10 Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 7/64 (10%) Frame = +1 Query: 193 NSSNRFHLENQSMPEFSNPKLGNEPRFEITYPDQKLVNGHKKEQG-------IVGPHILQ 351 +SSN F LENQ +P+FSN KL N PRFEI YPD+K VN + Q I G H++ Sbjct: 11 SSSNGFQLENQPVPDFSNRKLVNAPRFEIIYPDKKPVNRQHRNQSAPLQQHHIEGLHLIP 70 Query: 352 NQPF 363 NQPF Sbjct: 71 NQPF 74 >ref|XP_011077642.1| PREDICTED: scarecrow-like protein 9 [Sesamum indicum] gi|747062284|ref|XP_011077643.1| PREDICTED: scarecrow-like protein 9 [Sesamum indicum] Length = 758 Score = 60.1 bits (144), Expect = 3e-08 Identities = 34/65 (52%), Positives = 39/65 (60%), Gaps = 6/65 (9%) Frame = +1 Query: 190 FNSSNRFHLENQSMPEFSNPKLGNEPRFEITYPDQKLVNGHKKEQGIV------GPHILQ 351 FNSSNR L NQS EFSN + P FEITYPDQK V+ H+ + G H+L Sbjct: 9 FNSSNRIQLGNQSTAEFSN---WDGPGFEITYPDQKQVHRHRNQSSSFQQPSNGGVHLLS 65 Query: 352 NQPFS 366 NQPFS Sbjct: 66 NQPFS 70 >ref|XP_009804922.1| PREDICTED: scarecrow-like protein 9 [Nicotiana sylvestris] Length = 768 Score = 54.7 bits (130), Expect = 2e-06 Identities = 31/56 (55%), Positives = 34/56 (60%), Gaps = 4/56 (7%) Frame = +1 Query: 178 MNSRFNS----SNRFHLENQSMPEFSNPKLGNEPRFEITYPDQKLVNGHKKEQGIV 333 M+ RFNS N F LENQS+P SN NEPRFE Y DQKLVNG + E V Sbjct: 1 MDPRFNSFPTSMNGFSLENQSLPISSNRWKNNEPRFEAIYQDQKLVNGPRFENNFV 56