BLASTX nr result
ID: Rehmannia28_contig00044681
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00044681 (315 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB06352.1| hypothetical protein B456_001G000500 [Gossypium r... 55 3e-07 ref|XP_012434104.1| PREDICTED: probable ribonuclease P/MRP prote... 53 2e-06 >gb|KJB06352.1| hypothetical protein B456_001G000500 [Gossypium raimondii] Length = 154 Score = 54.7 bits (130), Expect = 3e-07 Identities = 25/47 (53%), Positives = 34/47 (72%) Frame = +2 Query: 146 GNLISVRKNHLKCDKLKFELLKLLAWDCLSSEINRFMQNCLPKIRIL 286 GN+ + + LKCD+LKFE KL+ CLS+++ + MQNCL KIRIL Sbjct: 106 GNIKACKTATLKCDELKFEQYKLMVGACLSADVTQHMQNCLEKIRIL 152 >ref|XP_012434104.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Gossypium raimondii] gi|823119914|ref|XP_012440718.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Gossypium raimondii] gi|823119916|ref|XP_012447714.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Gossypium raimondii] gi|823119918|ref|XP_012453878.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Gossypium raimondii] gi|823119920|ref|XP_012460866.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Gossypium raimondii] gi|823119922|ref|XP_012466605.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Gossypium raimondii] gi|823119924|ref|XP_012467262.1| PREDICTED: probable ribonuclease P/MRP protein subunit POP5 [Gossypium raimondii] gi|763738850|gb|KJB06349.1| hypothetical protein B456_001G000500 [Gossypium raimondii] gi|763738852|gb|KJB06351.1| hypothetical protein B456_001G000500 [Gossypium raimondii] gi|763738854|gb|KJB06353.1| hypothetical protein B456_001G000500 [Gossypium raimondii] Length = 154 Score = 52.8 bits (125), Expect = 2e-06 Identities = 24/47 (51%), Positives = 34/47 (72%) Frame = +2 Query: 146 GNLISVRKNHLKCDKLKFELLKLLAWDCLSSEINRFMQNCLPKIRIL 286 G++ + + LKCD+LKFE KL+ CLS+++ + MQNCL KIRIL Sbjct: 106 GSIKACKTATLKCDELKFEQYKLMVGACLSADVTQHMQNCLEKIRIL 152