BLASTX nr result
ID: Rehmannia28_contig00044635
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00044635 (316 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837725.1| PREDICTED: replication protein A 70 kDa DNA-... 72 2e-20 >ref|XP_012837725.1| PREDICTED: replication protein A 70 kDa DNA-binding subunit B-like [Erythranthe guttata] gi|604332613|gb|EYU37212.1| hypothetical protein MIMGU_mgv11b022413mg [Erythranthe guttata] Length = 515 Score = 71.6 bits (174), Expect(2) = 2e-20 Identities = 33/64 (51%), Positives = 42/64 (65%) Frame = +2 Query: 125 WSLTISDPVKVVELSMTQRIKGFKEVTLQQIIHNRECLDEDTFYCFKGFVENVLNKPSLW 304 W I+DP+K+ L+M +RIK +VTL +IIHNR L ED +Y FK V V NK +W Sbjct: 244 WLAQINDPLKIQALAMKERIKKANKVTLHEIIHNRFLLSEDEYYFFKATVNKVENKSYIW 303 Query: 305 YDSC 316 YDSC Sbjct: 304 YDSC 307 Score = 54.3 bits (129), Expect(2) = 2e-20 Identities = 22/44 (50%), Positives = 32/44 (72%) Frame = +3 Query: 6 HPIVVSLWEDMAQNEGHVLHQIENEKPIVAITKLIAKKYYGHLQ 137 H ++VSLWEDMA NEG L +I E P++++ ++ A+KY G LQ Sbjct: 177 HSVIVSLWEDMATNEGGELQEIAAENPVISLAQVTARKYQGELQ 220