BLASTX nr result
ID: Rehmannia28_contig00044536
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00044536 (382 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26154.1| hypothetical protein MIMGU_mgv1a022901mg [Erythra... 51 1e-06 ref|XP_012850895.1| PREDICTED: S-locus-specific glycoprotein S6-... 51 1e-06 ref|XP_011097978.1| PREDICTED: G-type lectin S-receptor-like ser... 47 6e-06 >gb|EYU26154.1| hypothetical protein MIMGU_mgv1a022901mg [Erythranthe guttata] Length = 774 Score = 51.2 bits (121), Expect(2) = 1e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -1 Query: 73 GWNLVYAIPKDLCDDYDKCGPNGI 2 GW+LVY IPKD CDDY KCGPNGI Sbjct: 293 GWDLVYTIPKDPCDDYAKCGPNGI 316 Score = 28.1 bits (61), Expect(2) = 1e-06 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 119 SGLLHRYTMNERKDIW 72 SG LHRYT+N+ K+ W Sbjct: 279 SGTLHRYTLNDEKNGW 294 >ref|XP_012850895.1| PREDICTED: S-locus-specific glycoprotein S6-like [Erythranthe guttata] Length = 497 Score = 51.2 bits (121), Expect(2) = 1e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -1 Query: 73 GWNLVYAIPKDLCDDYDKCGPNGI 2 GW+LVY IPKD CDDY KCGPNGI Sbjct: 293 GWDLVYTIPKDPCDDYAKCGPNGI 316 Score = 28.1 bits (61), Expect(2) = 1e-06 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 119 SGLLHRYTMNERKDIW 72 SG LHRYT+N+ K+ W Sbjct: 279 SGTLHRYTLNDEKNGW 294 >ref|XP_011097978.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Sesamum indicum] Length = 810 Score = 46.6 bits (109), Expect(2) = 6e-06 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -1 Query: 91 MKEKIYGWNLVYAIPKDLCDDYDKCGPNGI 2 M EK WNLV+ +P+DLCD+Y +CGP GI Sbjct: 272 MNEKKDKWNLVFTLPQDLCDNYGRCGPYGI 301 Score = 30.0 bits (66), Expect(2) = 6e-06 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 119 SGLLHRYTMNERKDIW 72 SG+L RY+MNE+KD W Sbjct: 264 SGILQRYSMNEKKDKW 279