BLASTX nr result
ID: Rehmannia28_contig00044510
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00044510 (337 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102519.1| hypothetical protein L484_014575 [Morus nota... 55 6e-07 emb|CAN78601.1| hypothetical protein VITISV_007377 [Vitis vinifera] 54 7e-07 ref|XP_010915964.1| PREDICTED: heme-binding protein 2-like [Elae... 52 7e-06 ref|XP_011071931.1| PREDICTED: heme-binding protein 2-like [Sesa... 52 7e-06 ref|XP_007205897.1| hypothetical protein PRUPE_ppa011373mg [Prun... 52 9e-06 ref|XP_008227506.1| PREDICTED: heme-binding protein 2-like [Prun... 52 9e-06 ref|XP_008385426.1| PREDICTED: heme-binding protein 2-like [Malu... 52 9e-06 >ref|XP_010102519.1| hypothetical protein L484_014575 [Morus notabilis] gi|587905421|gb|EXB93583.1| hypothetical protein L484_014575 [Morus notabilis] Length = 173 Score = 54.7 bits (130), Expect = 6e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 85 RLFQYTEGANLNFSRISMTVPVLTSIVP 2 RLFQY +GANLNFSRISMTVPVLTSIVP Sbjct: 20 RLFQYIQGANLNFSRISMTVPVLTSIVP 47 >emb|CAN78601.1| hypothetical protein VITISV_007377 [Vitis vinifera] Length = 168 Score = 54.3 bits (129), Expect = 7e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 Query: 106 LQISLGCRLFQYTEGANLNFSRISMTVPVLTSIVP 2 LQI RLFQY +GANLNFSRI+MT PVLTSIVP Sbjct: 11 LQILHTARLFQYIQGANLNFSRIAMTAPVLTSIVP 45 >ref|XP_010915964.1| PREDICTED: heme-binding protein 2-like [Elaeis guineensis] Length = 219 Score = 52.4 bits (124), Expect = 7e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -1 Query: 85 RLFQYTEGANLNFSRISMTVPVLTSIVP 2 RLFQY EGANLN+SRISMT PVLTSIVP Sbjct: 70 RLFQYIEGANLNWSRISMTTPVLTSIVP 97 >ref|XP_011071931.1| PREDICTED: heme-binding protein 2-like [Sesamum indicum] Length = 224 Score = 52.4 bits (124), Expect = 7e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -1 Query: 85 RLFQYTEGANLNFSRISMTVPVLTSIVP 2 RLFQ+ EGANLNFSRI MTVPVLTSIVP Sbjct: 74 RLFQFIEGANLNFSRIPMTVPVLTSIVP 101 >ref|XP_007205897.1| hypothetical protein PRUPE_ppa011373mg [Prunus persica] gi|462401539|gb|EMJ07096.1| hypothetical protein PRUPE_ppa011373mg [Prunus persica] Length = 213 Score = 52.0 bits (123), Expect = 9e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 85 RLFQYTEGANLNFSRISMTVPVLTSIVP 2 RLFQY +GANLNFSRI+MT PVLTSIVP Sbjct: 63 RLFQYIQGANLNFSRIAMTAPVLTSIVP 90 >ref|XP_008227506.1| PREDICTED: heme-binding protein 2-like [Prunus mume] Length = 221 Score = 52.0 bits (123), Expect = 9e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 85 RLFQYTEGANLNFSRISMTVPVLTSIVP 2 RLFQY +GANLNFSRI+MT PVLTSIVP Sbjct: 71 RLFQYIQGANLNFSRIAMTAPVLTSIVP 98 >ref|XP_008385426.1| PREDICTED: heme-binding protein 2-like [Malus domestica] Length = 223 Score = 52.0 bits (123), Expect = 9e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 85 RLFQYTEGANLNFSRISMTVPVLTSIVP 2 RLFQY +GANLNFSRI+MT PVLTSIVP Sbjct: 73 RLFQYIQGANLNFSRIAMTAPVLTSIVP 100