BLASTX nr result
ID: Rehmannia28_contig00044296
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00044296 (360 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837725.1| PREDICTED: replication protein A 70 kDa DNA-... 46 3e-07 >ref|XP_012837725.1| PREDICTED: replication protein A 70 kDa DNA-binding subunit B-like [Erythranthe guttata] gi|604332613|gb|EYU37212.1| hypothetical protein MIMGU_mgv11b022413mg [Erythranthe guttata] Length = 515 Score = 45.8 bits (107), Expect(2) = 3e-07 Identities = 21/42 (50%), Positives = 32/42 (76%) Frame = -3 Query: 280 TNEEKVLDDILDQHPILAITKVT*KKYIGELQLQTTITSILQ 155 TNE L +I ++P++++ +VT +KY GELQLQTT+ SI+Q Sbjct: 189 TNEGGELQEIAAENPVISLAQVTARKYQGELQLQTTMASIMQ 230 Score = 35.4 bits (80), Expect(2) = 3e-07 Identities = 17/39 (43%), Positives = 27/39 (69%) Frame = -1 Query: 117 LVSKNNPMKVRELTMIQRMKVAKEVSLNESIYTRDALSE 1 L N+P+K++ L M +R+K A +V+L+E I+ R LSE Sbjct: 245 LAQINDPLKIQALAMKERIKKANKVTLHEIIHNRFLLSE 283