BLASTX nr result
ID: Rehmannia28_contig00044168
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00044168 (300 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078598.1| PREDICTED: two-component response regulator ... 59 3e-08 ref|XP_012844135.1| PREDICTED: two-component response regulator ... 59 5e-08 ref|XP_011084015.1| PREDICTED: two-component response regulator ... 53 4e-06 ref|XP_012844140.1| PREDICTED: two-component response regulator ... 53 4e-06 ref|XP_012844139.1| PREDICTED: two-component response regulator ... 53 5e-06 ref|XP_012844137.1| PREDICTED: two-component response regulator ... 53 5e-06 ref|XP_015061688.1| PREDICTED: two-component response regulator ... 53 6e-06 ref|XP_004251765.1| PREDICTED: two-component response regulator ... 53 6e-06 >ref|XP_011078598.1| PREDICTED: two-component response regulator ARR12-like [Sesamum indicum] Length = 682 Score = 59.3 bits (142), Expect = 3e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 87 MTVEEIRGDYENFPVGLRVLAVDDDPICL 1 MTVEEIRGD ENFPVG+RVLAVDDDPICL Sbjct: 1 MTVEEIRGDSENFPVGMRVLAVDDDPICL 29 >ref|XP_012844135.1| PREDICTED: two-component response regulator ARR12 [Erythranthe guttata] gi|604321144|gb|EYU31784.1| hypothetical protein MIMGU_mgv1a003291mg [Erythranthe guttata] Length = 594 Score = 58.5 bits (140), Expect = 5e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 87 MTVEEIRGDYENFPVGLRVLAVDDDPICL 1 MTVEEIRGD +NFPVGLRVLAVDDDPICL Sbjct: 1 MTVEEIRGDGDNFPVGLRVLAVDDDPICL 29 >ref|XP_011084015.1| PREDICTED: two-component response regulator ARR12-like [Sesamum indicum] Length = 683 Score = 53.1 bits (126), Expect = 4e-06 Identities = 27/32 (84%), Positives = 28/32 (87%), Gaps = 3/32 (9%) Frame = -1 Query: 87 MTVEEIRGDYEN---FPVGLRVLAVDDDPICL 1 MTVE+IRGD EN FPVGLRVLAVDDDPICL Sbjct: 1 MTVEKIRGDNENSDNFPVGLRVLAVDDDPICL 32 >ref|XP_012844140.1| PREDICTED: two-component response regulator ARR12-like isoform X3 [Erythranthe guttata] Length = 258 Score = 52.8 bits (125), Expect = 4e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 87 MTVEEIRGDYENFPVGLRVLAVDDDPICL 1 MTVEEIRG+ +NFPVGLRVLAVDDDPI L Sbjct: 1 MTVEEIRGNGDNFPVGLRVLAVDDDPISL 29 >ref|XP_012844139.1| PREDICTED: two-component response regulator ARR12-like isoform X2 [Erythranthe guttata] Length = 279 Score = 52.8 bits (125), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 87 MTVEEIRGDYENFPVGLRVLAVDDDPICL 1 MTVEEIRG+ +NFPVGLRVLAVDDDPI L Sbjct: 1 MTVEEIRGNGDNFPVGLRVLAVDDDPISL 29 >ref|XP_012844137.1| PREDICTED: two-component response regulator ARR12-like isoform X1 [Erythranthe guttata] gi|604321146|gb|EYU31786.1| hypothetical protein MIMGU_mgv1a011483mg [Erythranthe guttata] Length = 280 Score = 52.8 bits (125), Expect = 5e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 87 MTVEEIRGDYENFPVGLRVLAVDDDPICL 1 MTVEEIRG+ +NFPVGLRVLAVDDDPI L Sbjct: 1 MTVEEIRGNGDNFPVGLRVLAVDDDPISL 29 >ref|XP_015061688.1| PREDICTED: two-component response regulator ORR24-like [Solanum pennellii] Length = 708 Score = 52.8 bits (125), Expect = 6e-06 Identities = 26/36 (72%), Positives = 29/36 (80%), Gaps = 7/36 (19%) Frame = -1 Query: 87 MTVEEIRGD-------YENFPVGLRVLAVDDDPICL 1 MTVEEIRG+ Y+NFPVG+RVLAVDDDPICL Sbjct: 1 MTVEEIRGNMGGERENYDNFPVGMRVLAVDDDPICL 36 >ref|XP_004251765.1| PREDICTED: two-component response regulator ARR12-like [Solanum lycopersicum] Length = 708 Score = 52.8 bits (125), Expect = 6e-06 Identities = 26/36 (72%), Positives = 29/36 (80%), Gaps = 7/36 (19%) Frame = -1 Query: 87 MTVEEIRGD-------YENFPVGLRVLAVDDDPICL 1 MTVEEIRG+ Y+NFPVG+RVLAVDDDPICL Sbjct: 1 MTVEEIRGNMGGERENYDNFPVGMRVLAVDDDPICL 36