BLASTX nr result
ID: Rehmannia28_contig00044097
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00044097 (381 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071059.1| PREDICTED: cyclin-D1-1-like [Sesamum indicum] 80 2e-15 ref|XP_011086502.1| PREDICTED: cyclin-D1-1 [Sesamum indicum] 80 2e-15 emb|CAB61221.1| cyclin D1 [Antirrhinum majus] 79 5e-15 gb|EYU22467.1| hypothetical protein MIMGU_mgv1a019051mg, partial... 78 9e-15 ref|XP_012855206.1| PREDICTED: cyclin-D1-1-like [Erythranthe gut... 78 9e-15 ref|XP_012846587.1| PREDICTED: cyclin-D1-1 [Erythranthe guttata]... 75 8e-14 ref|XP_009627754.1| PREDICTED: cyclin-D1-1 [Nicotiana tomentosif... 61 1e-08 ref|XP_011463387.1| PREDICTED: cyclin-D1-1 [Fragaria vesca subsp... 60 3e-08 ref|XP_015076909.1| PREDICTED: cyclin-D1-1 isoform X2 [Solanum p... 60 4e-08 ref|XP_006355943.1| PREDICTED: cyclin-D1-1 [Solanum tuberosum] 60 4e-08 ref|XP_015582229.1| PREDICTED: cyclin-D1-1 [Ricinus communis] 60 4e-08 ref|XP_015076908.1| PREDICTED: cyclin-D1-1 isoform X1 [Solanum p... 60 4e-08 gb|EEF30993.1| cyclin d, putative [Ricinus communis] 60 4e-08 ref|XP_009773645.1| PREDICTED: cyclin-D1-1 [Nicotiana sylvestris] 59 8e-08 ref|XP_012092465.1| PREDICTED: cyclin-D1-1 [Jatropha curcas] 59 8e-08 gb|KDP21306.1| hypothetical protein JCGZ_21777 [Jatropha curcas] 59 1e-07 ref|XP_004238706.1| PREDICTED: cyclin-D1-1 [Solanum lycopersicum] 58 2e-07 gb|EPS59976.1| hypothetical protein M569_14829, partial [Genlise... 55 3e-07 gb|KYP66214.1| Cyclin-D1-1 [Cajanus cajan] 56 9e-07 ref|XP_007044533.1| Cyclin-D1-1 isoform 1 [Theobroma cacao] gi|5... 55 1e-06 >ref|XP_011071059.1| PREDICTED: cyclin-D1-1-like [Sesamum indicum] Length = 337 Score = 80.1 bits (196), Expect = 2e-15 Identities = 41/53 (77%), Positives = 41/53 (77%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFSGGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MS CSDC SDLLCGE S II SGG D S EYSSDLESP EVEESIA LLED Sbjct: 1 MSVSCSDCFSDLLCGEDSTIILSGGGDLSSEYSSDLESPTAEVEESIARLLED 53 >ref|XP_011086502.1| PREDICTED: cyclin-D1-1 [Sesamum indicum] Length = 327 Score = 79.7 bits (195), Expect = 2e-15 Identities = 40/53 (75%), Positives = 43/53 (81%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFSGGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MS CSDC SDLLCGE S+IIFSGG D PEYSSD+ES +VEESIAGLLED Sbjct: 1 MSLSCSDCFSDLLCGEDSSIIFSGGGDDLPEYSSDIESRQLDVEESIAGLLED 53 >emb|CAB61221.1| cyclin D1 [Antirrhinum majus] Length = 330 Score = 79.0 bits (193), Expect = 5e-15 Identities = 39/53 (73%), Positives = 43/53 (81%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFSGGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MS CSDC SDLLCGE SNIIFSGG D PEY+SD+ES +V+ESIAGLLED Sbjct: 1 MSLSCSDCFSDLLCGEDSNIIFSGGGDDLPEYTSDVESIPTDVDESIAGLLED 53 >gb|EYU22467.1| hypothetical protein MIMGU_mgv1a019051mg, partial [Erythranthe guttata] Length = 293 Score = 77.8 bits (190), Expect = 9e-15 Identities = 43/55 (78%), Positives = 45/55 (81%), Gaps = 2/55 (3%) Frame = +2 Query: 221 MSFPCS-DCVSDLLCGEASN-IIFSGGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MSF CS DC SDLL GEASN II S G DYSPEYSSDLES P+VEE+IAGLLED Sbjct: 1 MSFSCSSDCFSDLLSGEASNNIILSAGGDYSPEYSSDLESRPPDVEEAIAGLLED 55 >ref|XP_012855206.1| PREDICTED: cyclin-D1-1-like [Erythranthe guttata] Length = 295 Score = 77.8 bits (190), Expect = 9e-15 Identities = 43/55 (78%), Positives = 45/55 (81%), Gaps = 2/55 (3%) Frame = +2 Query: 221 MSFPCS-DCVSDLLCGEASN-IIFSGGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MSF CS DC SDLL GEASN II S G DYSPEYSSDLES P+VEE+IAGLLED Sbjct: 1 MSFSCSSDCFSDLLSGEASNNIILSAGGDYSPEYSSDLESRPPDVEEAIAGLLED 55 >ref|XP_012846587.1| PREDICTED: cyclin-D1-1 [Erythranthe guttata] gi|604317961|gb|EYU29703.1| hypothetical protein MIMGU_mgv1a010022mg [Erythranthe guttata] Length = 324 Score = 75.5 bits (184), Expect = 8e-14 Identities = 39/53 (73%), Positives = 41/53 (77%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFSGGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MS CSDC SDLLC E SNIIFS G D PEYSSDL+S +VEESIAGLLED Sbjct: 1 MSLSCSDCFSDLLCSEDSNIIFSCGGDELPEYSSDLDSNPIDVEESIAGLLED 53 >ref|XP_009627754.1| PREDICTED: cyclin-D1-1 [Nicotiana tomentosiformis] Length = 336 Score = 61.2 bits (147), Expect = 1e-08 Identities = 33/56 (58%), Positives = 41/56 (73%), Gaps = 3/56 (5%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFS--GGKDYSPE-YSSDLESPLPEVEESIAGLLED 379 MS CSDC SDLLCGE S+ +F+ GG + SPE SSD+ES + +ESIAGL+ED Sbjct: 1 MSVSCSDCFSDLLCGEDSDTVFTNGGGGEDSPECSSSDIESQFVDFDESIAGLIED 56 >ref|XP_011463387.1| PREDICTED: cyclin-D1-1 [Fragaria vesca subsp. vesca] Length = 345 Score = 60.1 bits (144), Expect = 3e-08 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFSGGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MS CSDC+SDLLCGE S+ I SG SPE SSD+ESP EESIAG +ED Sbjct: 1 MSLSCSDCLSDLLCGEDSSEILSG---ESPECSSDIESPACS-EESIAGFIED 49 >ref|XP_015076909.1| PREDICTED: cyclin-D1-1 isoform X2 [Solanum pennellii] Length = 336 Score = 59.7 bits (143), Expect = 4e-08 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 2/55 (3%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFS--GGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MS SDC SDLLCGE S+ +FS GG+D SSD+ES +++ESIAGL+ED Sbjct: 1 MSVSYSDCFSDLLCGEDSDTVFSNGGGEDLPECSSSDIESQFADIDESIAGLIED 55 >ref|XP_006355943.1| PREDICTED: cyclin-D1-1 [Solanum tuberosum] Length = 336 Score = 59.7 bits (143), Expect = 4e-08 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 2/55 (3%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFS--GGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MS SDC SDLLCGE S+ +FS GG+D SSD+ES +++ESIAGL+ED Sbjct: 1 MSVSYSDCFSDLLCGEDSDTVFSNGGGEDLPECSSSDIESQFADIDESIAGLIED 55 >ref|XP_015582229.1| PREDICTED: cyclin-D1-1 [Ricinus communis] Length = 337 Score = 59.7 bits (143), Expect = 4e-08 Identities = 34/53 (64%), Positives = 37/53 (69%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFSGGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MS CSDC +DLLC E S+ IFS G SPEYSSDLESP V ESIA +ED Sbjct: 1 MSLSCSDCFNDLLCSEDSSEIFSTGD--SPEYSSDLESPAGTV-ESIASFIED 50 >ref|XP_015076908.1| PREDICTED: cyclin-D1-1 isoform X1 [Solanum pennellii] Length = 338 Score = 59.7 bits (143), Expect = 4e-08 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 2/55 (3%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFS--GGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MS SDC SDLLCGE S+ +FS GG+D SSD+ES +++ESIAGL+ED Sbjct: 1 MSVSYSDCFSDLLCGEDSDTVFSNGGGEDLPECSSSDIESQFADIDESIAGLIED 55 >gb|EEF30993.1| cyclin d, putative [Ricinus communis] Length = 386 Score = 59.7 bits (143), Expect = 4e-08 Identities = 34/53 (64%), Positives = 37/53 (69%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFSGGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MS CSDC +DLLC E S+ IFS G SPEYSSDLESP V ESIA +ED Sbjct: 40 MSLSCSDCFNDLLCSEDSSEIFSTGD--SPEYSSDLESPAGTV-ESIASFIED 89 >ref|XP_009773645.1| PREDICTED: cyclin-D1-1 [Nicotiana sylvestris] Length = 336 Score = 58.9 bits (141), Expect = 8e-08 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 3/56 (5%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFS--GGKDYSPE-YSSDLESPLPEVEESIAGLLED 379 MS CS+C SDLLCGE S+ + S GG + SPE SSD+ES + +ESIAGL+ED Sbjct: 1 MSVSCSECFSDLLCGEDSDTVLSNGGGGEDSPECSSSDIESQFADFDESIAGLIED 56 >ref|XP_012092465.1| PREDICTED: cyclin-D1-1 [Jatropha curcas] Length = 263 Score = 58.5 bits (140), Expect = 8e-08 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFSGGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MS PCSDC +DLLC E S+ IFS SPE SSDLESP +EESIA +ED Sbjct: 1 MSLPCSDCFTDLLCSEDSSEIFSA---ESPECSSDLESP-AFIEESIASFIED 49 >gb|KDP21306.1| hypothetical protein JCGZ_21777 [Jatropha curcas] Length = 338 Score = 58.5 bits (140), Expect = 1e-07 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFSGGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MS PCSDC +DLLC E S+ IFS SPE SSDLESP +EESIA +ED Sbjct: 1 MSLPCSDCFTDLLCSEDSSEIFSA---ESPECSSDLESP-AFIEESIASFIED 49 >ref|XP_004238706.1| PREDICTED: cyclin-D1-1 [Solanum lycopersicum] Length = 337 Score = 57.8 bits (138), Expect = 2e-07 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 2/55 (3%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFSGGK--DYSPEYSSDLESPLPEVEESIAGLLED 379 MS SDC SDLLCGE S+ +FS G+ D SSD+ES +++ESIAGL+ED Sbjct: 1 MSVSYSDCFSDLLCGEDSDTVFSNGRGEDLPECSSSDIESQFADIDESIAGLIED 55 >gb|EPS59976.1| hypothetical protein M569_14829, partial [Genlisea aurea] Length = 113 Score = 54.7 bits (130), Expect = 3e-07 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 2/50 (4%) Frame = +2 Query: 236 SDC-VSDLLCGEASNIIFSGGKDYSPEYSSDLESPLP-EVEESIAGLLED 379 SDC SDLLCGE S++IFS SPEY+SD++S LP E E+ I+GLLE+ Sbjct: 1 SDCFTSDLLCGEDSSVIFSDSCSDSPEYASDVDSCLPSEFEDFISGLLEE 50 >gb|KYP66214.1| Cyclin-D1-1 [Cajanus cajan] Length = 335 Score = 55.8 bits (133), Expect = 9e-07 Identities = 33/55 (60%), Positives = 37/55 (67%), Gaps = 2/55 (3%) Frame = +2 Query: 221 MSFPCSDCVSD--LLCGEASNIIFSGGKDYSPEYSSDLESPLPEVEESIAGLLED 379 MS CS+C D LLCGE S+ I SG SPE SSDL+S PE EESIAG +ED Sbjct: 1 MSVSCSNCFPDSFLLCGEDSSEILSGD---SPECSSDLDSSPPEEEESIAGFIED 52 >ref|XP_007044533.1| Cyclin-D1-1 isoform 1 [Theobroma cacao] gi|508708468|gb|EOY00365.1| Cyclin-D1-1 isoform 1 [Theobroma cacao] Length = 355 Score = 55.5 bits (132), Expect = 1e-06 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +2 Query: 221 MSFPCSDCVSDLLCGEASNIIFSGGKDYSPEYSSDLESPLPEVEE-SIAGLLED 379 MS CSDC +DLLC E S+ IFSG SPE SS+L+SP +EE SIAG +ED Sbjct: 1 MSVSCSDCFTDLLCCEDSDEIFSG---ESPECSSELDSPASFIEESSIAGFIED 51