BLASTX nr result
ID: Rehmannia28_contig00043353
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00043353 (343 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092144.1| PREDICTED: pentatricopeptide repeat-containi... 62 7e-09 >ref|XP_011092144.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Sesamum indicum] gi|747089048|ref|XP_011092145.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Sesamum indicum] gi|747089050|ref|XP_011092147.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09820 [Sesamum indicum] Length = 623 Score = 61.6 bits (148), Expect = 7e-09 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +2 Query: 233 PFASDPDFQSQVSSLISNQKWSELKPIIESSNPTDFL 343 PF S PDF+S +SSLISN KWS+LK I ESSNPTDFL Sbjct: 50 PFVSGPDFESLISSLISNHKWSQLKSITESSNPTDFL 86