BLASTX nr result
ID: Rehmannia28_contig00043040
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00043040 (584 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009780195.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-11 ref|XP_009618316.1| PREDICTED: pentatricopeptide repeat-containi... 70 8e-11 ref|XP_012837736.1| PREDICTED: pentatricopeptide repeat-containi... 68 5e-10 ref|XP_015057317.1| PREDICTED: pentatricopeptide repeat-containi... 64 8e-09 ref|XP_004250478.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 emb|CDO99888.1| unnamed protein product [Coffea canephora] 61 9e-08 ref|XP_006436646.1| hypothetical protein CICLE_v10030857mg [Citr... 61 9e-08 gb|EYU37193.1| hypothetical protein MIMGU_mgv1a021143mg [Erythra... 58 1e-06 gb|KDO42139.1| hypothetical protein CISIN_1g005881mg [Citrus sin... 56 6e-06 ref|XP_010242606.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_011621127.1| PREDICTED: pentatricopeptide repeat-containi... 55 9e-06 >ref|XP_009780195.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Nicotiana sylvestris] Length = 698 Score = 71.2 bits (173), Expect = 3e-11 Identities = 47/141 (33%), Positives = 73/141 (51%), Gaps = 2/141 (1%) Frame = -1 Query: 419 IINDEAIYARLMVSGFPPRRPKEQTFLRNH--NMQLETLTTLMVQKLFDKMPVRNLVKLD 246 ++N +A++A+L+ G K F NH M L+ Q+LFD+MP RN++ Sbjct: 16 LLNGKAVHAKLLKFG-----SKANVFTNNHLLAMYLKLNQFDDAQRLFDRMPERNIISW- 69 Query: 245 SSNILVFNWGCWRNKP*FVSGQLFLQMGLLQISNICVGAVLACDNTRAL*TGRRIHERIY 66 ++ I ++ K + L+ G V A+ AC + A TG+ +H R+Y Sbjct: 70 TTLISTYSQMGMSEKALDCFRSMVLEDGFAPNGYTYVAALSACTSLGAERTGKELHGRMY 129 Query: 65 RAEVNINSFLFNCLVKFYGKC 3 R E ++NSF+ NCLV FYGKC Sbjct: 130 RTEESLNSFVTNCLVNFYGKC 150 >ref|XP_009618316.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Nicotiana tomentosiformis] Length = 698 Score = 70.1 bits (170), Expect = 8e-11 Identities = 48/151 (31%), Positives = 76/151 (50%), Gaps = 12/151 (7%) Frame = -1 Query: 419 IINDEAIYARLMVSGFPPRRPKEQTFLRNHN--MQLETLTTLMVQKLFDKMPVRNLVKLD 246 ++N +A++A+L+ G P ++ NH M L+ Q+L D+MP RN++ Sbjct: 16 LLNGKAVHAQLLKFGSKP-----DVYINNHLLVMYLKLNQFADAQQLLDRMPERNII--- 67 Query: 245 SSNILVFNW----------GCWRNKP*FVSGQLFLQMGLLQISNICVGAVLACDNTRAL* 96 S L+ + GC+R+ + L+ G V A+ AC + A Sbjct: 68 SWTTLISTYSQKGMSEKALGCFRS--------MVLEDGFAPNGYTYVAALSACTSLGAER 119 Query: 95 TGRRIHERIYRAEVNINSFLFNCLVKFYGKC 3 TG+ +H R+YR E ++NSF+ NCLV FYGKC Sbjct: 120 TGKELHGRMYRTEESLNSFVTNCLVNFYGKC 150 >ref|XP_012837736.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Erythranthe guttata] Length = 648 Score = 67.8 bits (164), Expect = 5e-10 Identities = 48/147 (32%), Positives = 73/147 (49%), Gaps = 2/147 (1%) Frame = -1 Query: 437 SAQTNLIINDEAIYARLMVSGFPPRRPKEQTFLRNHNMQLETLTTLM--VQKLFDKMPVR 264 SA I N +AI+ARL++SG NH + + + + QKLFD+M VR Sbjct: 10 SAAKKSIFNGKAIHARLIISGLD-----RDVQTNNHLLSMYSKIGYIGYAQKLFDEMLVR 64 Query: 263 NLVKLDSSNILVFNWGCWRNKP*FVSGQLFLQMGLLQISNICVGAVLACDNTRAL*TGRR 84 N++ +S I ++ K + L G+ V A+ AC AL G+ Sbjct: 65 NVITW-TSLISAYSQLGLSEKALSCFQLMVLDDGIAPNEYTFVAAISACAQVGALRNGKE 123 Query: 83 IHERIYRAEVNINSFLFNCLVKFYGKC 3 IH ++YR+E +N+F+ N L+ FYGKC Sbjct: 124 IHGKMYRSEETVNTFVNNSLINFYGKC 150 >ref|XP_015057317.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Solanum pennellii] Length = 702 Score = 64.3 bits (155), Expect = 8e-09 Identities = 47/148 (31%), Positives = 75/148 (50%), Gaps = 9/148 (6%) Frame = -1 Query: 419 IINDEAIYARLMVSGFPPRRPKEQTFLRNH--NMQLETLTTLMVQKLFDKMPVRNLVKLD 246 + N ++++A+L+ G K F NH M L+ Q+LFD+MP RN++ Sbjct: 16 LFNGKSLHAQLLKLG----SLKADIFTNNHLLTMYLKLNQFDDAQQLFDRMPERNIISWT 71 Query: 245 S-----SNILVFN--WGCWRNKP*FVSGQLFLQMGLLQISNICVGAVLACDNTRAL*TGR 87 + S + ++ GC+R+ + L+ G V A+ AC + A TG+ Sbjct: 72 TLISTYSQLGMYEKALGCFRS--------MNLEDGFGPNGYTYVAALSACSSLGAERTGK 123 Query: 86 RIHERIYRAEVNINSFLFNCLVKFYGKC 3 +H R+ R E ++NSF+ NCLV FYGKC Sbjct: 124 ELHGRMLRTEESLNSFVSNCLVNFYGKC 151 >ref|XP_004250478.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Solanum lycopersicum] Length = 702 Score = 63.5 bits (153), Expect = 1e-08 Identities = 48/151 (31%), Positives = 73/151 (48%), Gaps = 12/151 (7%) Frame = -1 Query: 419 IINDEAIYARLMVSGFPPRRPKEQTFLRNH--NMQLETLTTLMVQKLFDKMPVRNLVKLD 246 + N ++++A+L+ G K F NH M L+ Q+LFD+MP RN++ Sbjct: 16 LFNGKSLHAQLLKLG----SLKADIFTNNHLLTMYLKLNQFDDAQQLFDRMPERNII--- 68 Query: 245 SSNILVFNW----------GCWRNKP*FVSGQLFLQMGLLQISNICVGAVLACDNTRAL* 96 S L+ + GC+R+ + L+ G V A+ AC + A Sbjct: 69 SWTTLISTYTQLGMYEKALGCFRS--------MNLEDGFGPNGYTYVAALSACSSLGAER 120 Query: 95 TGRRIHERIYRAEVNINSFLFNCLVKFYGKC 3 TG+ +H R+ R E +NSF+ NCLV FYGKC Sbjct: 121 TGKELHGRMLRTEERLNSFVSNCLVNFYGKC 151 >emb|CDO99888.1| unnamed protein product [Coffea canephora] Length = 637 Score = 61.2 bits (147), Expect = 9e-08 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = -1 Query: 164 GLLQISNICVGAVLACDNTRAL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKC 3 G L + VGA+ AC NTRA+ G+ IH RIYR + ++NSF+ N LV FYGKC Sbjct: 36 GFLPNEHTYVGAISACVNTRAVSIGKEIHGRIYRTQDSLNSFVSNSLVNFYGKC 89 >ref|XP_006436646.1| hypothetical protein CICLE_v10030857mg [Citrus clementina] gi|567888250|ref|XP_006436647.1| hypothetical protein CICLE_v10030857mg [Citrus clementina] gi|568878438|ref|XP_006492198.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] gi|985468913|ref|XP_015380606.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] gi|985468915|ref|XP_015380607.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] gi|985468917|ref|XP_015380608.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] gi|985468919|ref|XP_015380609.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] gi|985468921|ref|XP_015380610.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Citrus sinensis] gi|557538842|gb|ESR49886.1| hypothetical protein CICLE_v10030857mg [Citrus clementina] gi|557538843|gb|ESR49887.1| hypothetical protein CICLE_v10030857mg [Citrus clementina] Length = 697 Score = 61.2 bits (147), Expect = 9e-08 Identities = 45/157 (28%), Positives = 75/157 (47%), Gaps = 18/157 (11%) Frame = -1 Query: 419 IINDEAIYARLMVSGFPPRRPKEQTFLRNHNMQLETLTTLM--VQKLFDKMPVRNLVKLD 246 I+ ++A+++ SGF P NH + + + + QKLFD+MP RN++ Sbjct: 16 ILKGRTLHAKMITSGFHPN-----VITYNHLLLMYVKFSRINDAQKLFDEMPERNVI--- 67 Query: 245 SSNILVFNWGCWRNKP*FVSGQLFLQMGLLQIS------NIC----------VGAVLACD 114 +W +SG F Q+G+ +++ +C VGAV AC Sbjct: 68 -------SWSA------LISG--FSQIGMPEVALNYFRLMVCCVLEPNYYTYVGAVSACA 112 Query: 113 NTRAL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKC 3 + +G+ IH R+YR+ + +NS + NCL+ YGKC Sbjct: 113 SRGDARSGKEIHGRMYRSGLELNSHVSNCLINMYGKC 149 >gb|EYU37193.1| hypothetical protein MIMGU_mgv1a021143mg [Erythranthe guttata] Length = 605 Score = 57.8 bits (138), Expect = 1e-06 Identities = 35/97 (36%), Positives = 52/97 (53%) Frame = -1 Query: 293 QKLFDKMPVRNLVKLDSSNILVFNWGCWRNKP*FVSGQLFLQMGLLQISNICVGAVLACD 114 QKLFD+M VRN++ +S I ++ K + L G+ V A+ AC Sbjct: 12 QKLFDEMLVRNVITW-TSLISAYSQLGLSEKALSCFQLMVLDDGIAPNEYTFVAAISACA 70 Query: 113 NTRAL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKC 3 AL G+ IH ++YR+E +N+F+ N L+ FYGKC Sbjct: 71 QVGALRNGKEIHGKMYRSEETVNTFVNNSLINFYGKC 107 >gb|KDO42139.1| hypothetical protein CISIN_1g005881mg [Citrus sinensis] Length = 672 Score = 55.8 bits (133), Expect = 6e-06 Identities = 37/113 (32%), Positives = 57/113 (50%), Gaps = 16/113 (14%) Frame = -1 Query: 293 QKLFDKMPVRNLVKLDSSNILVFNWGCWRNKP*FVSGQLFLQMGLLQIS------NIC-- 138 QKLFD+MP RN++ +W +SG F Q+G+ +++ +C Sbjct: 30 QKLFDEMPERNVI----------SWSA------LISG--FSQIGMPEVALNYFRLMVCCV 71 Query: 137 --------VGAVLACDNTRAL*TGRRIHERIYRAEVNINSFLFNCLVKFYGKC 3 VGAV AC + +G+ IH R+YR+ + +NS + NCL+ YGKC Sbjct: 72 LEPNYYTYVGAVSACASRGDARSGKEIHGRMYRSGLELNSHVSNCLINMYGKC 124 >ref|XP_010242606.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Nelumbo nucifera] Length = 697 Score = 55.8 bits (133), Expect = 6e-06 Identities = 44/150 (29%), Positives = 70/150 (46%), Gaps = 7/150 (4%) Frame = -1 Query: 431 QTNLIINDEAIYARLMVSGFPPRRPKEQTFLRNH--NMQLETLTTLMVQKLFDKMPVRNL 258 +T ++ ++A ++ SGF + NH +M ++ ++L +++P RNL Sbjct: 12 ETGCVLKGRTVHAMIITSGF-----SLDVYTSNHLVSMYVKFGRFDDARRLLNQLPDRNL 66 Query: 257 VKLDSSNILVFNWGCWRNKP*FVSGQL-----FLQMGLLQISNICVGAVLACDNTRAL*T 93 V S +L+ + R F L + G+ V A+ AC NT A T Sbjct: 67 V---SWTVLIAGYSQAR----FAEEALDCFRSMVAEGINPNHYTYVSAISACANTGAART 119 Query: 92 GRRIHERIYRAEVNINSFLFNCLVKFYGKC 3 G+ +H +IYR E NSF+ NCLV Y KC Sbjct: 120 GKEVHGKIYRTEQEPNSFVDNCLVNLYVKC 149 >ref|XP_011621127.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Amborella trichopoda] Length = 652 Score = 55.5 bits (132), Expect = 9e-06 Identities = 40/138 (28%), Positives = 71/138 (51%), Gaps = 5/138 (3%) Frame = -1 Query: 401 IYARLMVSGFPPRRPKEQTFLRNHNMQLETLTTLM--VQKLFDKMPVRNLVKLDSSNILV 228 ++A ++VSGF P +L NH M + + + + LFDKMP R+ V ++ Sbjct: 6 LHAHVIVSGFQP-----DLYLSNHLMNMYSKCGCLDDARNLFDKMPHRDSVSYNTMIACY 60 Query: 227 FNWGCWRNKP*FVSGQLFLQMGLL--QISNICVGAVL-ACDNTRAL*TGRRIHERIYRAE 57 +G N + ++F M L ++ + V +V+ AC N L GR++H + + Sbjct: 61 DKYGPCEN-----ALEVFRAMKLSGSKVDHFTVSSVISACMNISFLCQGRQVHSDVIKIG 115 Query: 56 VNINSFLFNCLVKFYGKC 3 + +N ++ + LV+FYGKC Sbjct: 116 IGLNVYVGSALVEFYGKC 133