BLASTX nr result
ID: Rehmannia28_contig00042873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00042873 (612 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012848450.1| PREDICTED: dof zinc finger protein DOF1.6-li... 70 5e-11 ref|XP_011087020.1| PREDICTED: dof zinc finger protein DOF5.8-li... 62 3e-08 ref|XP_011096259.1| PREDICTED: dof zinc finger protein DOF1.4-li... 57 2e-06 >ref|XP_012848450.1| PREDICTED: dof zinc finger protein DOF1.6-like [Erythranthe guttata] gi|604315230|gb|EYU27936.1| hypothetical protein MIMGU_mgv1a027127mg [Erythranthe guttata] Length = 293 Score = 70.1 bits (170), Expect = 5e-11 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 4/48 (8%) Frame = +1 Query: 1 WPGPNTSGCLDQLPNYWNWNEIDVFLTSSDHLNISWDDE----AEIKP 132 WPGPNT+ L+ +P+YWNWNEID LTSSDHL+ISW D+ AEIKP Sbjct: 247 WPGPNTTSSLE-MPSYWNWNEIDDVLTSSDHLDISWPDDDYDKAEIKP 293 >ref|XP_011087020.1| PREDICTED: dof zinc finger protein DOF5.8-like [Sesamum indicum] Length = 296 Score = 62.4 bits (150), Expect = 3e-08 Identities = 30/45 (66%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = +1 Query: 1 WPGPNTSGCLDQLPNYWNWNEIDVFLTSSDHLNISWDD-EAEIKP 132 WP +TS +D LPNYWNWNEID F +S+D LNI+WDD +AEIKP Sbjct: 254 WPVADTSSVMD-LPNYWNWNEIDAFTSSAD-LNIAWDDIDAEIKP 296 >ref|XP_011096259.1| PREDICTED: dof zinc finger protein DOF1.4-like [Sesamum indicum] Length = 293 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = +1 Query: 1 WPGPNTSGCLDQLPNYWNWNEIDVFLTSSDHLNISWDDE-AEIKP 132 WPGP++ +D LPN WNWNEID LTS+D LNISWDD+ AE KP Sbjct: 252 WPGPDSMSPMD-LPNCWNWNEIDA-LTSAD-LNISWDDDVAETKP 293