BLASTX nr result
ID: Rehmannia28_contig00042723
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00042723 (389 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012829701.1| PREDICTED: haloacid dehalogenase-like hydrol... 59 8e-08 >ref|XP_012829701.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3 [Erythranthe guttata] gi|604344997|gb|EYU43636.1| hypothetical protein MIMGU_mgv1a012346mg [Erythranthe guttata] gi|604344998|gb|EYU43637.1| hypothetical protein MIMGU_mgv1a012346mg [Erythranthe guttata] Length = 253 Score = 58.5 bits (140), Expect = 8e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 388 TPDAESWRKSGATVLPNLVTVQDWLSSEQKG 296 TPDAE+W+KSGATVLPNLV VQ+WLSSE+ G Sbjct: 222 TPDAENWKKSGATVLPNLVAVQEWLSSEEHG 252