BLASTX nr result
ID: Rehmannia28_contig00042511
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00042511 (398 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14457.1| unnamed protein product [Coffea canephora] 57 2e-08 >emb|CDP14457.1| unnamed protein product [Coffea canephora] Length = 97 Score = 57.4 bits (137), Expect = 2e-08 Identities = 25/58 (43%), Positives = 42/58 (72%) Frame = -3 Query: 396 FFEWYDPMMCRRSTQIIPGLIRTINQRQDTINQMKLRERKYIITLIVSWIVLGVVIFF 223 +FEWYD +MCRRST +IPGL+R++N + TI +++ ERK L+ + ++L +++ F Sbjct: 32 YFEWYDLIMCRRSTALIPGLLRSMNAKDATIEKLRAWERK----LVSATVLLALLLLF 85