BLASTX nr result
ID: Rehmannia28_contig00042491
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00042491 (1216 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73128.1| hypothetical protein M569_01628, partial [Genlise... 120 9e-29 ref|XP_011092226.1| PREDICTED: uncharacterized protein LOC105172... 124 4e-28 ref|XP_011088108.1| PREDICTED: enhancer of polycomb-like protein... 119 2e-26 gb|EPS74424.1| hypothetical protein M569_00331, partial [Genlise... 117 2e-26 ref|XP_012839845.1| PREDICTED: uncharacterized protein LOC105960... 118 6e-26 ref|XP_012086614.1| PREDICTED: uncharacterized protein LOC105645... 118 8e-26 gb|KHG01169.1| enhancer of polycomb-like protein 1 [Gossypium ar... 116 1e-25 emb|CDP17761.1| unnamed protein product [Coffea canephora] 117 2e-25 gb|KJB68974.1| hypothetical protein B456_011G001300 [Gossypium r... 116 2e-25 gb|KJB68975.1| hypothetical protein B456_011G001300 [Gossypium r... 116 2e-25 ref|XP_012456114.1| PREDICTED: uncharacterized protein LOC105777... 116 3e-25 ref|XP_008357098.1| PREDICTED: uncharacterized protein LOC103420... 109 3e-25 gb|KHN47670.1| hypothetical protein glysoja_037771 [Glycine soja] 108 5e-25 gb|KVH96155.1| Enhancer of polycomb-like, N-terminal [Cynara car... 114 1e-24 ref|XP_015066959.1| PREDICTED: enhancer of polycomb-like protein... 113 1e-24 gb|ACU17719.1| unknown [Glycine max] 108 1e-24 gb|KYP40745.1| hypothetical protein KK1_037923 [Cajanus cajan] 108 2e-24 gb|KOM56125.1| hypothetical protein LR48_Vigan10g201700 [Vigna a... 110 2e-24 ref|XP_015066958.1| PREDICTED: enhancer of polycomb-like protein... 113 3e-24 ref|XP_004232643.1| PREDICTED: enhancer of polycomb-like protein... 113 3e-24 >gb|EPS73128.1| hypothetical protein M569_01628, partial [Genlisea aurea] Length = 187 Score = 120 bits (300), Expect = 9e-29 Identities = 59/74 (79%), Positives = 63/74 (85%) Frame = -2 Query: 1197 ARKLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWL 1018 A + SEIPTPEFVIVDTYERDYSRTF+Q SYLRARG RAEI EFV+YDLDNEDEDWL Sbjct: 51 AGRKATSEIPTPEFVIVDTYERDYSRTFSQPTSYLRARGGRAEIGEFVEYDLDNEDEDWL 110 Query: 1017 QDFNKE*KTLVAEK 976 QDFNKE K L +EK Sbjct: 111 QDFNKEGKHLASEK 124 >ref|XP_011092226.1| PREDICTED: uncharacterized protein LOC105172481 [Sesamum indicum] gi|747089199|ref|XP_011092227.1| PREDICTED: uncharacterized protein LOC105172481 [Sesamum indicum] Length = 451 Score = 124 bits (312), Expect = 4e-28 Identities = 61/68 (89%), Positives = 63/68 (92%) Frame = -2 Query: 1179 SEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWLQDFNKE 1000 SEIPTPEFV+VDTYERDYSRTF Q SYLRARGARAEI EFV+YDLDNEDEDWLQDFNKE Sbjct: 61 SEIPTPEFVVVDTYERDYSRTFIQPTSYLRARGARAEIGEFVEYDLDNEDEDWLQDFNKE 120 Query: 999 *KTLVAEK 976 KTLVAEK Sbjct: 121 RKTLVAEK 128 >ref|XP_011088108.1| PREDICTED: enhancer of polycomb-like protein 1, partial [Sesamum indicum] Length = 440 Score = 119 bits (299), Expect = 2e-26 Identities = 58/72 (80%), Positives = 63/72 (87%) Frame = -2 Query: 1191 KLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWLQD 1012 K + SEIPTP+FV+VDTYERDYS TF Q SYLRARGARAEI EFV+YDLDNEDEDWLQ+ Sbjct: 57 KKVASEIPTPQFVVVDTYERDYSPTFTQPTSYLRARGARAEIGEFVEYDLDNEDEDWLQE 116 Query: 1011 FNKE*KTLVAEK 976 FNKE KTL AEK Sbjct: 117 FNKERKTLAAEK 128 >gb|EPS74424.1| hypothetical protein M569_00331, partial [Genlisea aurea] Length = 346 Score = 117 bits (294), Expect = 2e-26 Identities = 57/74 (77%), Positives = 62/74 (83%) Frame = -2 Query: 1197 ARKLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWL 1018 A K SEIPTPEFV+VDTYE+DYSRTF+Q SYLRARGAR+EI EF+ YDLDNEDEDWL Sbjct: 51 ASKKAASEIPTPEFVVVDTYEKDYSRTFSQPASYLRARGARSEIGEFLDYDLDNEDEDWL 110 Query: 1017 QDFNKE*KTLVAEK 976 DFNKE K L AEK Sbjct: 111 HDFNKEGKNLAAEK 124 >ref|XP_012839845.1| PREDICTED: uncharacterized protein LOC105960220 [Erythranthe guttata] gi|604330329|gb|EYU35394.1| hypothetical protein MIMGU_mgv1a006226mg [Erythranthe guttata] Length = 452 Score = 118 bits (296), Expect = 6e-26 Identities = 57/68 (83%), Positives = 61/68 (89%) Frame = -2 Query: 1179 SEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWLQDFNKE 1000 SEIPTPEFV VDTYERDYSRTF+Q SYLRARGARAEI EFV+YDLDNEDEDWL++FNKE Sbjct: 61 SEIPTPEFVYVDTYERDYSRTFSQPTSYLRARGARAEIGEFVEYDLDNEDEDWLEEFNKE 120 Query: 999 *KTLVAEK 976 TL AEK Sbjct: 121 RNTLAAEK 128 >ref|XP_012086614.1| PREDICTED: uncharacterized protein LOC105645584 [Jatropha curcas] gi|802546722|ref|XP_012086622.1| PREDICTED: uncharacterized protein LOC105645584 [Jatropha curcas] gi|643738877|gb|KDP44691.1| hypothetical protein JCGZ_01191 [Jatropha curcas] Length = 454 Score = 118 bits (295), Expect = 8e-26 Identities = 58/72 (80%), Positives = 62/72 (86%) Frame = -2 Query: 1191 KLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWLQD 1012 K L EIPTP+FVIVDTYERDYSRTF+Q SYLRARGARAEI EFV+YDLDNEDEDWLQD Sbjct: 58 KKLAPEIPTPQFVIVDTYERDYSRTFSQPTSYLRARGARAEIGEFVEYDLDNEDEDWLQD 117 Query: 1011 FNKE*KTLVAEK 976 FNKE K L E+ Sbjct: 118 FNKERKNLSPER 129 >gb|KHG01169.1| enhancer of polycomb-like protein 1 [Gossypium arboreum] Length = 396 Score = 116 bits (291), Expect = 1e-25 Identities = 57/74 (77%), Positives = 62/74 (83%) Frame = -2 Query: 1197 ARKLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWL 1018 A K L EIPTP+FV+VDTYERDYSRTF Q SYLRARGARAEI EFV+YDLDNEDEDWL Sbjct: 17 ATKKLAPEIPTPQFVVVDTYERDYSRTFFQPTSYLRARGARAEIGEFVEYDLDNEDEDWL 76 Query: 1017 QDFNKE*KTLVAEK 976 QD+NK+ K L EK Sbjct: 77 QDYNKDKKILAPEK 90 >emb|CDP17761.1| unnamed protein product [Coffea canephora] Length = 452 Score = 117 bits (292), Expect = 2e-25 Identities = 54/68 (79%), Positives = 62/68 (91%) Frame = -2 Query: 1179 SEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWLQDFNKE 1000 +EIPTP+FV+VDTYERDYSRTF Q SYLRARGARAEI EF++YDLDNEDEDWLQ+FN+E Sbjct: 61 AEIPTPQFVVVDTYERDYSRTFGQPTSYLRARGARAEIGEFIEYDLDNEDEDWLQEFNRE 120 Query: 999 *KTLVAEK 976 K L+AEK Sbjct: 121 RKILLAEK 128 >gb|KJB68974.1| hypothetical protein B456_011G001300 [Gossypium raimondii] Length = 426 Score = 116 bits (291), Expect = 2e-25 Identities = 57/74 (77%), Positives = 62/74 (83%) Frame = -2 Query: 1197 ARKLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWL 1018 A K L EIPTP+FV+VDTYERDYSRTF Q SYLRARGARAEI EFV+YDLDNEDEDWL Sbjct: 57 ATKKLAPEIPTPQFVVVDTYERDYSRTFFQPTSYLRARGARAEIGEFVEYDLDNEDEDWL 116 Query: 1017 QDFNKE*KTLVAEK 976 QD+NK+ K L EK Sbjct: 117 QDYNKDKKILAPEK 130 >gb|KJB68975.1| hypothetical protein B456_011G001300 [Gossypium raimondii] Length = 436 Score = 116 bits (291), Expect = 2e-25 Identities = 57/74 (77%), Positives = 62/74 (83%) Frame = -2 Query: 1197 ARKLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWL 1018 A K L EIPTP+FV+VDTYERDYSRTF Q SYLRARGARAEI EFV+YDLDNEDEDWL Sbjct: 57 ATKKLAPEIPTPQFVVVDTYERDYSRTFFQPTSYLRARGARAEIGEFVEYDLDNEDEDWL 116 Query: 1017 QDFNKE*KTLVAEK 976 QD+NK+ K L EK Sbjct: 117 QDYNKDKKILAPEK 130 >ref|XP_012456114.1| PREDICTED: uncharacterized protein LOC105777404 [Gossypium raimondii] gi|763802034|gb|KJB68972.1| hypothetical protein B456_011G001300 [Gossypium raimondii] gi|763802035|gb|KJB68973.1| hypothetical protein B456_011G001300 [Gossypium raimondii] Length = 453 Score = 116 bits (291), Expect = 3e-25 Identities = 57/74 (77%), Positives = 62/74 (83%) Frame = -2 Query: 1197 ARKLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWL 1018 A K L EIPTP+FV+VDTYERDYSRTF Q SYLRARGARAEI EFV+YDLDNEDEDWL Sbjct: 57 ATKKLAPEIPTPQFVVVDTYERDYSRTFFQPTSYLRARGARAEIGEFVEYDLDNEDEDWL 116 Query: 1017 QDFNKE*KTLVAEK 976 QD+NK+ K L EK Sbjct: 117 QDYNKDKKILAPEK 130 >ref|XP_008357098.1| PREDICTED: uncharacterized protein LOC103420833 [Malus domestica] Length = 146 Score = 109 bits (272), Expect = 3e-25 Identities = 51/67 (76%), Positives = 57/67 (85%) Frame = -2 Query: 1176 EIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWLQDFNKE* 997 EIPTP+FV+VDTYERDYSRTF Q SYLRARGARAE+ EFV+YDLDNEDEDWL +FNK+ Sbjct: 66 EIPTPQFVVVDTYERDYSRTFGQPNSYLRARGARAELXEFVEYDLDNEDEDWLYEFNKDR 125 Query: 996 KTLVAEK 976 K L K Sbjct: 126 KILCTRK 132 >gb|KHN47670.1| hypothetical protein glysoja_037771 [Glycine soja] Length = 129 Score = 108 bits (269), Expect = 5e-25 Identities = 53/71 (74%), Positives = 59/71 (83%) Frame = -2 Query: 1191 KLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWLQD 1012 K L SEIPTP+FV+VDTYERDYS TF+Q SYLRARGARAEI EFV+YDLDNEDEDWL + Sbjct: 58 KKLASEIPTPQFVVVDTYERDYSCTFSQPTSYLRARGARAEIGEFVEYDLDNEDEDWLFE 117 Query: 1011 FNKE*KTLVAE 979 FN+E L E Sbjct: 118 FNEERNILTPE 128 >gb|KVH96155.1| Enhancer of polycomb-like, N-terminal [Cynara cardunculus var. scolymus] Length = 432 Score = 114 bits (286), Expect = 1e-24 Identities = 57/74 (77%), Positives = 62/74 (83%) Frame = -2 Query: 1197 ARKLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWL 1018 A K SEIPTPE+VIVDTYERDYS TFNQ SYLRARGARAEI +FV+YDLDNEDEDWL Sbjct: 56 ASKKTVSEIPTPEYVIVDTYERDYSPTFNQPASYLRARGARAEIGDFVEYDLDNEDEDWL 115 Query: 1017 QDFNKE*KTLVAEK 976 ++FNKE L AEK Sbjct: 116 EEFNKERTILPAEK 129 >ref|XP_015066959.1| PREDICTED: enhancer of polycomb-like protein 1 isoform X2 [Solanum pennellii] Length = 369 Score = 113 bits (283), Expect = 1e-24 Identities = 55/72 (76%), Positives = 60/72 (83%) Frame = -2 Query: 1191 KLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWLQD 1012 K L EIPTPE+VIVDTYERDYS TF Q SY+ ARGARAEI EFV+YDLDNEDEDWLQ+ Sbjct: 57 KKLAPEIPTPEYVIVDTYERDYSPTFGQPTSYIHARGARAEIGEFVEYDLDNEDEDWLQE 116 Query: 1011 FNKE*KTLVAEK 976 FN+E K L AEK Sbjct: 117 FNRERKVLAAEK 128 >gb|ACU17719.1| unknown [Glycine max] Length = 174 Score = 108 bits (270), Expect = 1e-24 Identities = 53/71 (74%), Positives = 59/71 (83%) Frame = -2 Query: 1191 KLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWLQD 1012 K L SEIPTP+FV+VDTYERDYS TF+Q SYLRARG RAEI EFV+YDLDNEDEDWL + Sbjct: 58 KKLASEIPTPQFVVVDTYERDYSCTFSQPTSYLRARGTRAEIGEFVEYDLDNEDEDWLFE 117 Query: 1011 FNKE*KTLVAE 979 FN+E K L E Sbjct: 118 FNEERKILTPE 128 >gb|KYP40745.1| hypothetical protein KK1_037923 [Cajanus cajan] Length = 185 Score = 108 bits (270), Expect = 2e-24 Identities = 54/71 (76%), Positives = 60/71 (84%) Frame = -2 Query: 1191 KLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWLQD 1012 K L +EIPTP+FVIVDTYERDYS TF+Q SYLRARGARAEI EFV+YDLDNEDEDWL + Sbjct: 57 KKLAAEIPTPQFVIVDTYERDYSCTFSQPNSYLRARGARAEIGEFVEYDLDNEDEDWLFE 116 Query: 1011 FNKE*KTLVAE 979 FN+E K L E Sbjct: 117 FNEERKILAPE 127 >gb|KOM56125.1| hypothetical protein LR48_Vigan10g201700 [Vigna angularis] Length = 266 Score = 110 bits (275), Expect = 2e-24 Identities = 55/71 (77%), Positives = 59/71 (83%) Frame = -2 Query: 1191 KLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWLQD 1012 K L +EIPTP+FVIVDTYERDYS TF+Q SYLRARGARAEI EFV+YDLDNEDEDWL Sbjct: 58 KKLAAEIPTPQFVIVDTYERDYSCTFSQPTSYLRARGARAEIGEFVEYDLDNEDEDWLYH 117 Query: 1011 FNKE*KTLVAE 979 FNKE K L E Sbjct: 118 FNKERKILAPE 128 >ref|XP_015066958.1| PREDICTED: enhancer of polycomb-like protein 1 isoform X1 [Solanum pennellii] Length = 447 Score = 113 bits (283), Expect = 3e-24 Identities = 55/72 (76%), Positives = 60/72 (83%) Frame = -2 Query: 1191 KLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWLQD 1012 K L EIPTPE+VIVDTYERDYS TF Q SY+ ARGARAEI EFV+YDLDNEDEDWLQ+ Sbjct: 57 KKLAPEIPTPEYVIVDTYERDYSPTFGQPTSYIHARGARAEIGEFVEYDLDNEDEDWLQE 116 Query: 1011 FNKE*KTLVAEK 976 FN+E K L AEK Sbjct: 117 FNRERKVLAAEK 128 >ref|XP_004232643.1| PREDICTED: enhancer of polycomb-like protein 1 [Solanum lycopersicum] Length = 447 Score = 113 bits (283), Expect = 3e-24 Identities = 55/72 (76%), Positives = 60/72 (83%) Frame = -2 Query: 1191 KLLNSEIPTPEFVIVDTYERDYSRTFNQRISYLRARGARAEIREFVKYDLDNEDEDWLQD 1012 K L EIPTPE+VIVDTYERDYS TF Q SY+ ARGARAEI EFV+YDLDNEDEDWLQ+ Sbjct: 57 KKLAPEIPTPEYVIVDTYERDYSPTFGQPTSYIHARGARAEIGEFVEYDLDNEDEDWLQE 116 Query: 1011 FNKE*KTLVAEK 976 FN+E K L AEK Sbjct: 117 FNRERKVLAAEK 128