BLASTX nr result
ID: Rehmannia28_contig00042443
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00042443 (618 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079341.1| PREDICTED: putative glycine-rich cell wall s... 59 1e-07 >ref|XP_011079341.1| PREDICTED: putative glycine-rich cell wall structural protein 1 [Sesamum indicum] Length = 143 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +1 Query: 118 MAKLKLYVIVAFLVISALVTASESRVARKDLGLDL 222 MAKLK Y+++AFLVISA VT SESRVARKDLGLDL Sbjct: 1 MAKLKSYIVLAFLVISAFVTVSESRVARKDLGLDL 35