BLASTX nr result
ID: Rehmannia28_contig00042389
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00042389 (495 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009760679.1| PREDICTED: cytochrome c oxidase subunit 5b-1... 59 2e-08 gb|KVH93024.1| cytochrome c oxidase, subunit Vb [Cynara carduncu... 55 9e-07 gb|KJB53600.1| hypothetical protein B456_009G1296002, partial [G... 54 1e-06 ref|XP_012856797.1| PREDICTED: cytochrome c oxidase subunit 5b-1... 55 1e-06 ref|XP_011072251.1| PREDICTED: cytochrome c oxidase subunit 5b-1... 55 1e-06 ref|XP_011081184.1| PREDICTED: cytochrome c oxidase subunit 5b-1... 55 1e-06 gb|KHN01351.1| Cytochrome c oxidase subunit 5b-2, mitochondrial ... 54 2e-06 gb|KJB70574.1| hypothetical protein B456_011G080500 [Gossypium r... 54 2e-06 emb|CDY68151.1| BnaAnng26290D [Brassica napus] 54 2e-06 ref|XP_010497846.1| PREDICTED: cytochrome c oxidase subunit 5b-1... 52 2e-06 emb|CAN74336.1| hypothetical protein VITISV_010832 [Vitis vinifera] 54 2e-06 ref|XP_013739387.1| PREDICTED: cytochrome c oxidase subunit 5b-1... 54 2e-06 ref|XP_012456849.1| PREDICTED: cytochrome c oxidase subunit 5b-2... 54 3e-06 ref|XP_010543026.1| PREDICTED: cytochrome c oxidase subunit 5b-1... 54 3e-06 gb|AEQ61828.1| cytochrome c oxidase subunit Vb [Dimocarpus longan] 54 3e-06 ref|XP_007023938.1| Rubredoxin-like superfamily protein [Theobro... 54 4e-06 gb|KRH47499.1| hypothetical protein GLYMA_07G032800 [Glycine max] 54 4e-06 ref|XP_010545783.1| PREDICTED: cytochrome c oxidase subunit 5b-1... 54 4e-06 gb|KJB68130.1| hypothetical protein B456_010G227300 [Gossypium r... 54 4e-06 ref|XP_010535130.1| PREDICTED: cytochrome c oxidase subunit 5b-1... 54 4e-06 >ref|XP_009760679.1| PREDICTED: cytochrome c oxidase subunit 5b-1, mitochondrial-like [Nicotiana sylvestris] Length = 101 Score = 58.5 bits (140), Expect = 2e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 406 ISCLQEAPAVIKSYYDKRIVGCPGVEGEDE 495 + C+QEAPAV+KSYYD+RIVGCPG EGEDE Sbjct: 27 LMCMQEAPAVVKSYYDRRIVGCPGGEGEDE 56 >gb|KVH93024.1| cytochrome c oxidase, subunit Vb [Cynara cardunculus var. scolymus] Length = 139 Score = 55.1 bits (131), Expect = 9e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 415 LQEAPAVIKSYYDKRIVGCPGVEGEDE 495 LQEAPAV+KSYYD+RIVGCPG EGEDE Sbjct: 69 LQEAPAVVKSYYDQRIVGCPGGEGEDE 95 >gb|KJB53600.1| hypothetical protein B456_009G1296002, partial [Gossypium raimondii] Length = 84 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAV+KSYYDKRIVGCPG EGEDE Sbjct: 35 KEAPAVVKSYYDKRIVGCPGGEGEDE 60 >ref|XP_012856797.1| PREDICTED: cytochrome c oxidase subunit 5b-1, mitochondrial [Erythranthe guttata] gi|604302019|gb|EYU21605.1| hypothetical protein MIMGU_mgv1a015248mg [Erythranthe guttata] gi|604302020|gb|EYU21606.1| hypothetical protein MIMGU_mgv1a015248mg [Erythranthe guttata] Length = 163 Score = 55.1 bits (131), Expect = 1e-06 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAV+KSYYD+RIVGCPGVEGEDE Sbjct: 93 KEAPAVVKSYYDRRIVGCPGVEGEDE 118 >ref|XP_011072251.1| PREDICTED: cytochrome c oxidase subunit 5b-1, mitochondrial-like [Sesamum indicum] Length = 164 Score = 55.1 bits (131), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAVIKSYYDKRIVGCPG EGEDE Sbjct: 94 KEAPAVIKSYYDKRIVGCPGAEGEDE 119 >ref|XP_011081184.1| PREDICTED: cytochrome c oxidase subunit 5b-1, mitochondrial-like [Sesamum indicum] Length = 167 Score = 55.1 bits (131), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAVIKSYYDKRIVGCPG EGEDE Sbjct: 96 KEAPAVIKSYYDKRIVGCPGAEGEDE 121 >gb|KHN01351.1| Cytochrome c oxidase subunit 5b-2, mitochondrial [Glycine soja] Length = 102 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAV+KSYYDKRIVGCPG EGEDE Sbjct: 34 KEAPAVVKSYYDKRIVGCPGGEGEDE 59 >gb|KJB70574.1| hypothetical protein B456_011G080500 [Gossypium raimondii] Length = 103 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAV+KSYYDKRIVGCPG EGEDE Sbjct: 35 KEAPAVVKSYYDKRIVGCPGGEGEDE 60 >emb|CDY68151.1| BnaAnng26290D [Brassica napus] Length = 103 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAV+KSYYDKRIVGCPG EGEDE Sbjct: 34 KEAPAVVKSYYDKRIVGCPGGEGEDE 59 >ref|XP_010497846.1| PREDICTED: cytochrome c oxidase subunit 5b-1, mitochondrial, partial [Camelina sativa] Length = 49 Score = 52.0 bits (123), Expect = 2e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +1 Query: 421 EAPAVIKSYYDKRIVGCPGVEGEDE 495 E+PAV+KSYYDKRIVGCPG EGEDE Sbjct: 1 ESPAVVKSYYDKRIVGCPGGEGEDE 25 >emb|CAN74336.1| hypothetical protein VITISV_010832 [Vitis vinifera] Length = 110 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = +1 Query: 415 LQEAPAVIKSYYDKRIVGCPGVEGEDE 495 L+EAPAV++SYYDKRIVGCPG EGEDE Sbjct: 16 LREAPAVVQSYYDKRIVGCPGGEGEDE 42 >ref|XP_013739387.1| PREDICTED: cytochrome c oxidase subunit 5b-1, mitochondrial-like [Brassica napus] Length = 117 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAV+KSYYDKRIVGCPG EGEDE Sbjct: 48 KEAPAVVKSYYDKRIVGCPGGEGEDE 73 >ref|XP_012456849.1| PREDICTED: cytochrome c oxidase subunit 5b-2, mitochondrial-like [Gossypium raimondii] gi|763803637|gb|KJB70575.1| hypothetical protein B456_011G080500 [Gossypium raimondii] Length = 133 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAV+KSYYDKRIVGCPG EGEDE Sbjct: 65 KEAPAVVKSYYDKRIVGCPGGEGEDE 90 >ref|XP_010543026.1| PREDICTED: cytochrome c oxidase subunit 5b-1, mitochondrial-like, partial [Tarenaya hassleriana] Length = 154 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAVIKSYYDKRIVGCPG EGEDE Sbjct: 83 KEAPAVIKSYYDKRIVGCPGGEGEDE 108 >gb|AEQ61828.1| cytochrome c oxidase subunit Vb [Dimocarpus longan] Length = 140 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAV+KSYYDKRIVGCPG EGEDE Sbjct: 94 KEAPAVVKSYYDKRIVGCPGGEGEDE 119 >ref|XP_007023938.1| Rubredoxin-like superfamily protein [Theobroma cacao] gi|508779304|gb|EOY26560.1| Rubredoxin-like superfamily protein [Theobroma cacao] Length = 166 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAVIKSYYDKRIVGCPG EGEDE Sbjct: 97 KEAPAVIKSYYDKRIVGCPGGEGEDE 122 >gb|KRH47499.1| hypothetical protein GLYMA_07G032800 [Glycine max] Length = 147 Score = 53.5 bits (127), Expect = 4e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAV+KSYYDKRIVGCPG EGEDE Sbjct: 95 KEAPAVVKSYYDKRIVGCPGGEGEDE 120 >ref|XP_010545783.1| PREDICTED: cytochrome c oxidase subunit 5b-1, mitochondrial-like [Tarenaya hassleriana] Length = 171 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAVIKSYYDKRIVGCPG EGEDE Sbjct: 101 KEAPAVIKSYYDKRIVGCPGGEGEDE 126 >gb|KJB68130.1| hypothetical protein B456_010G227300 [Gossypium raimondii] Length = 151 Score = 53.5 bits (127), Expect = 4e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAV+KSYYDKRIVGCPG EGEDE Sbjct: 97 KEAPAVVKSYYDKRIVGCPGGEGEDE 122 >ref|XP_010535130.1| PREDICTED: cytochrome c oxidase subunit 5b-1, mitochondrial-like [Tarenaya hassleriana] Length = 173 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 418 QEAPAVIKSYYDKRIVGCPGVEGEDE 495 +EAPAVIKSYYDKRIVGCPG EGEDE Sbjct: 104 KEAPAVIKSYYDKRIVGCPGGEGEDE 129