BLASTX nr result
ID: Rehmannia28_contig00042242
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00042242 (391 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992361.1| hypothetical protein Salmi_Mp095 (mitochondr... 98 3e-22 emb|CBL52023.1| hypothetical protein (mitochondrion) [Beta vulga... 54 1e-06 >ref|YP_008992361.1| hypothetical protein Salmi_Mp095 (mitochondrion) [Salvia miltiorrhiza] gi|534292331|gb|AGU16623.1| hypothetical protein Salmi_Mp095 (mitochondrion) [Salvia miltiorrhiza] Length = 317 Score = 98.2 bits (243), Expect = 3e-22 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 6/80 (7%) Frame = +2 Query: 2 LNQILTESPFPERAIRTEALEFIVNC------LNQLDLSDPRSNLDKVALTGTLRYWLQD 163 L QIL ESPFPERAIRTEAL+FIV+ LNQ +LSDP S+ ++ +T L+YW+QD Sbjct: 237 LRQILLESPFPERAIRTEALDFIVDSIEKVGSLNQYNLSDPGSSFERRVVTTILQYWIQD 296 Query: 164 VQQNGHQSAFYLWFLDHFKG 223 +QQ+GH S FYL FLDHF G Sbjct: 297 IQQHGHLSPFYLQFLDHFMG 316 >emb|CBL52023.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 170 Score = 54.3 bits (129), Expect = 1e-06 Identities = 27/70 (38%), Positives = 39/70 (55%) Frame = +2 Query: 8 QILTESPFPERAIRTEALEFIVNCLNQLDLSDPRSNLDKVALTGTLRYWLQDVQQNGHQS 187 +IL ++ E I+ AL+FI + L + LSDPRSN D+ L W D+ Q +QS Sbjct: 98 EILKQTSLNEGQIKENALDFIEDFLQRFSLSDPRSNFDRRICESMLNSWNDDLNQRANQS 157 Query: 188 AFYLWFLDHF 217 Y FLD++ Sbjct: 158 LLYSEFLDYY 167