BLASTX nr result
ID: Rehmannia28_contig00042060
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00042060 (431 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEJ72569.1| putative reverse transcriptase family member [Mal... 54 4e-06 >gb|AEJ72569.1| putative reverse transcriptase family member [Malus domestica] Length = 212 Score = 53.9 bits (128), Expect = 4e-06 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -2 Query: 97 KGKFYKTIIRPAMFYGVECWATKYEYEQKMRV 2 KGKFY+T IRPAM YG ECWA KY++ KM V Sbjct: 68 KGKFYRTTIRPAMLYGTECWAVKYQHVHKMGV 99