BLASTX nr result
ID: Rehmannia28_contig00042019
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00042019 (389 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081908.1| PREDICTED: pleiotropic drug resistance prote... 65 7e-10 ref|XP_012855955.1| PREDICTED: pleiotropic drug resistance prote... 60 4e-08 gb|KVH90323.1| AAA+ ATPase domain-containing protein [Cynara car... 54 4e-06 ref|XP_010648604.1| PREDICTED: pleiotropic drug resistance prote... 54 4e-06 emb|CAN80954.1| hypothetical protein VITISV_032205 [Vitis vinifera] 54 4e-06 ref|XP_010648603.1| PREDICTED: pleiotropic drug resistance prote... 54 4e-06 >ref|XP_011081908.1| PREDICTED: pleiotropic drug resistance protein 1-like [Sesamum indicum] Length = 1451 Score = 65.1 bits (157), Expect = 7e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 293 IMEGGDIFRVSSARLSSSNIWRNTGMEAFSRS 388 +MEGGDIFRVSSARLSSSNIWRNTGMEAFSRS Sbjct: 1 MMEGGDIFRVSSARLSSSNIWRNTGMEAFSRS 32 >ref|XP_012855955.1| PREDICTED: pleiotropic drug resistance protein 1-like [Erythranthe guttata] gi|604302353|gb|EYU21929.1| hypothetical protein MIMGU_mgv1a023987mg [Erythranthe guttata] Length = 1434 Score = 60.1 bits (144), Expect = 4e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 296 MEGGDIFRVSSARLSSSNIWRNTGMEAFSRS 388 MEGGDIFRVSSARL SS+IWRNTGME+FSRS Sbjct: 1 MEGGDIFRVSSARLGSSSIWRNTGMESFSRS 31 >gb|KVH90323.1| AAA+ ATPase domain-containing protein [Cynara cardunculus var. scolymus] Length = 1408 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 296 MEGGDIFRVSSARLSSSNIWRNTGMEAFSRS 388 MEGGD+FRVSSAR+SSSNIWR +G + FSRS Sbjct: 1 MEGGDVFRVSSARISSSNIWRTSGRDIFSRS 31 >ref|XP_010648604.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform X2 [Vitis vinifera] gi|296081973|emb|CBI20978.3| unnamed protein product [Vitis vinifera] Length = 1436 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 296 MEGGDIFRVSSARLSSSNIWRNTGMEAFSRS 388 ME D++RV+SARLSSSNIWRN+GME FSRS Sbjct: 1 MESSDVYRVNSARLSSSNIWRNSGMEVFSRS 31 >emb|CAN80954.1| hypothetical protein VITISV_032205 [Vitis vinifera] Length = 1441 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 296 MEGGDIFRVSSARLSSSNIWRNTGMEAFSRS 388 ME D++RV+SARLSSSNIWRN+GME FSRS Sbjct: 1 MESSDVYRVNSARLSSSNIWRNSGMEVFSRS 31 >ref|XP_010648603.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform X1 [Vitis vinifera] Length = 1470 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 296 MEGGDIFRVSSARLSSSNIWRNTGMEAFSRS 388 ME D++RV+SARLSSSNIWRN+GME FSRS Sbjct: 1 MESSDVYRVNSARLSSSNIWRNSGMEVFSRS 31