BLASTX nr result
ID: Rehmannia28_contig00041951
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00041951 (443 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012858084.1| PREDICTED: uncharacterized protein LOC105977... 98 3e-23 ref|XP_004249962.1| PREDICTED: uncharacterized protein LOC101266... 62 4e-09 ref|XP_015057819.1| PREDICTED: uncharacterized protein LOC107004... 62 4e-09 ref|XP_009612139.1| PREDICTED: uncharacterized protein LOC104105... 57 3e-07 >ref|XP_012858084.1| PREDICTED: uncharacterized protein LOC105977329 [Erythranthe guttata] gi|604299972|gb|EYU19815.1| hypothetical protein MIMGU_mgv1a022370mg [Erythranthe guttata] Length = 159 Score = 97.8 bits (242), Expect = 3e-23 Identities = 48/65 (73%), Positives = 53/65 (81%) Frame = -1 Query: 437 EKKPGSLLFRSRSEPGGKSLVLVTEPGSPRVSCTGRVGFKNGDGKKTGFSRIFSSLFRAG 258 EKKPG LFRSRSEPG KS+VL+ EP SPRVSCTGRV FK DG+KT FSR+FSSLFR Sbjct: 93 EKKPGGFLFRSRSEPGWKSMVLLAEPVSPRVSCTGRVRFKTADGRKTRFSRLFSSLFRTR 152 Query: 257 SGKSR 243 S K+R Sbjct: 153 SQKNR 157 >ref|XP_004249962.1| PREDICTED: uncharacterized protein LOC101266780 [Solanum lycopersicum] Length = 198 Score = 62.0 bits (149), Expect = 4e-09 Identities = 33/64 (51%), Positives = 42/64 (65%) Frame = -1 Query: 416 LFRSRSEPGGKSLVLVTEPGSPRVSCTGRVGFKNGDGKKTGFSRIFSSLFRAGSGKSRAR 237 LFRSRSEPG K V+EPGSP+VSCTGRV K G +TGF + ++F+ +SRA+ Sbjct: 124 LFRSRSEPGRKGSTNVSEPGSPKVSCTGRVRSKKDRGVRTGFWKKLRTIFKI---RSRAK 180 Query: 236 KRGN 225 N Sbjct: 181 SVAN 184 >ref|XP_015057819.1| PREDICTED: uncharacterized protein LOC107004100 [Solanum pennellii] Length = 206 Score = 62.0 bits (149), Expect = 4e-09 Identities = 33/64 (51%), Positives = 42/64 (65%) Frame = -1 Query: 416 LFRSRSEPGGKSLVLVTEPGSPRVSCTGRVGFKNGDGKKTGFSRIFSSLFRAGSGKSRAR 237 LFRSRSEPG K V+EPGSP+VSCTGRV K G +TGF + ++F+ +SRA+ Sbjct: 124 LFRSRSEPGRKGSTNVSEPGSPKVSCTGRVRSKKDRGVRTGFWKKLRTIFKI---RSRAK 180 Query: 236 KRGN 225 N Sbjct: 181 SVAN 184 >ref|XP_009612139.1| PREDICTED: uncharacterized protein LOC104105517 [Nicotiana tomentosiformis] Length = 212 Score = 57.0 bits (136), Expect = 3e-07 Identities = 29/49 (59%), Positives = 33/49 (67%) Frame = -1 Query: 437 EKKPGSLLFRSRSEPGGKSLVLVTEPGSPRVSCTGRVGFKNGDGKKTGF 291 +KK LFRSRSEPG K + V EPGSP+VSC GRV K G +TGF Sbjct: 122 QKKVPKRLFRSRSEPGNKVIRNVREPGSPKVSCIGRVRSKKDRGIRTGF 170