BLASTX nr result
ID: Rehmannia28_contig00041780
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00041780 (331 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098156.1| PREDICTED: fatty-acid-binding protein 3 [Ses... 64 4e-10 >ref|XP_011098156.1| PREDICTED: fatty-acid-binding protein 3 [Sesamum indicum] Length = 289 Score = 64.3 bits (155), Expect = 4e-10 Identities = 38/78 (48%), Positives = 47/78 (60%), Gaps = 2/78 (2%) Frame = +2 Query: 104 MASTLAISTLVPHSSPA--KSKPSVVNPRICFFARSPNKPLLLLNYSNQFIANLSAFPSH 277 MAST+AIST + HSS K KPS +NPRICF A +PNK L L ++ + S FP + Sbjct: 1 MASTVAISTPLSHSSSPNPKGKPSNLNPRICFLATTPNKQLSALKHTK---TSASTFPPN 57 Query: 278 RVCIKRNGGHHNHLSPKA 331 +RN G LSPKA Sbjct: 58 LCIKRRNAGLEGRLSPKA 75