BLASTX nr result
ID: Rehmannia28_contig00041539
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00041539 (1009 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009797530.1| PREDICTED: putative uncharacterized protein ... 58 6e-06 >ref|XP_009797530.1| PREDICTED: putative uncharacterized protein DDB_G0286901 [Nicotiana sylvestris] gi|698503948|ref|XP_009797531.1| PREDICTED: putative uncharacterized protein DDB_G0286901 [Nicotiana sylvestris] Length = 415 Score = 58.2 bits (139), Expect = 6e-06 Identities = 33/57 (57%), Positives = 38/57 (66%) Frame = +3 Query: 690 VYQGNTEIGQPKFTISGSVDYTTPIKKLDKDGKHAELSEFWSQKTKIHQKEKLHFIK 860 VYQ N ++ Q K T+SGSVD T IKKL K GKHAEL WSQKT QK+ + IK Sbjct: 40 VYQVNIDVEQQKVTVSGSVDSETLIKKLVKAGKHAEL---WSQKTNQSQKQNPNCIK 93