BLASTX nr result
ID: Rehmannia28_contig00040989
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00040989 (325 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100079.1| PREDICTED: tRNA(His) guanylyltransferase 1-l... 55 1e-06 >ref|XP_011100079.1| PREDICTED: tRNA(His) guanylyltransferase 1-like [Sesamum indicum] Length = 531 Score = 55.1 bits (131), Expect = 1e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -2 Query: 324 AVCYPSCEILLDYLAWRQVDCKLISFFIFPFWYM 223 AVCYPSCEILLDYLAWRQVDC + + + FW + Sbjct: 398 AVCYPSCEILLDYLAWRQVDCHINNQYNTCFWML 431